From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0672 [new locus tag: SACOL_RS03475 ]
  • pan locus tag?: SAUPAN002485000
  • symbol: sarA
  • pan gene symbol?: sarA
  • synonym:
  • product: accessory regulator A

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0672 [new locus tag: SACOL_RS03475 ]
  • symbol: sarA
  • product: accessory regulator A
  • replicon: chromosome
  • strand: -
  • coordinates: 699976..700350
  • length: 375
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGCAATTACAAAAATCAATGATTGCTTTGAGTTGTTATCAATGGTCACTTATGCTGAC
    AAATTAAAAAGTTTAATTAAAAAGGAATTTTCAATTAGCTTTGAAGAATTCGCTGTATTG
    ACATACATCAGCGAAAACAAAGAGAAAGAATACTATCTTAAAGATATTATTAATCATTTA
    AACTACAAACAACCACAAGTTGTTAAAGCAGTTAAAATTTTATCTCAAGAAGATTACTTC
    GATAAAAAACGTAATGAGCATGATGAAAGAACTGTATTAATTCTTGTTAATGCACAACAA
    CGTAAAAAAATCGAATCATTATTGAGTCGAGTAAATAAACGAATCACTGAAGCAAACAAC
    GAAATTGAACTATAA
    60
    120
    180
    240
    300
    360
    375

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0672 [new locus tag: SACOL_RS03475 ]
  • symbol: SarA
  • description: accessory regulator A
  • length: 124
  • theoretical pI: 8.4094
  • theoretical MW: 14717.9
  • GRAVY: -0.495968

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 118)
    and 6 more
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)
    Metabolism Central intermediary metabolism Amino sugars UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 13)
    undecaprenyl-phosphate glucose phosphotransferase (TIGR03023; EC 2.7.8.-; HMM-score: 12.2)
    Genetic information processing Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 11.3)
  • TheSEED  :
    • Staphylococcal accessory regulator A (SarA)
    Regulation and Cell signaling Quorum sensing and biofilm formation Biofilm formation in Staphylococcus  Staphylococcal accessory regulator A (SarA)
  • PFAM:
    HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 87.2)
    and 4 more
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 25)
    MarR_2; MarR family (PF12802; HMM-score: 22.4)
    MarR; MarR family (PF01047; HMM-score: 19.9)
    P-loop_NTPase (CL0023) AAA_23; AAA domain (PF13476; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by SarA, TF important in Virulence: in JSNZ

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9019
    • Cytoplasmic Membrane Score: 0.0091
    • Cell wall & surface Score: 0.0007
    • Extracellular Score: 0.0884
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004617
    • TAT(Tat/SPI): 0.000227
    • LIPO(Sec/SPII): 0.000605
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4]
  • quantitative data / protein copy number per cell: 5273 [5]
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [6] [7]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 20.59 h [8]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  7. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  8. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

S Gertz, S Engelmann, R Schmid, A K Ziebandt, K Tischer, C Scharf, J Hacker, M Hecker
Characterization of the sigma(B) regulon in Staphylococcus aureus.
J Bacteriol: 2000, 182(24);6983-91
[PubMed:11092859] [WorldCat.org] [DOI] (P p)
María Pilar Trotonda, Yan Q Xiong, Guido Memmi, Arnold S Bayer, Ambrose L Cheung
Role of mgrA and sarA in methicillin-resistant Staphylococcus aureus autolysis and resistance to cell wall-active antibiotics.
J Infect Dis: 2009, 199(2);209-18
[PubMed:19072553] [WorldCat.org] [DOI] (P p)