From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001742 [new locus tag: EGJ38_RS08700 ]
  • pan locus tag?: SAUPAN004430000
  • symbol: EGJ38_001742
  • pan gene symbol?:
  • synonym: JSNZ_001742
  • product: YtxH domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001742 [new locus tag: EGJ38_RS08700 ]
  • symbol: EGJ38_001742
  • product: YtxH domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1789184..1789606
  • length: 423
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423698 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGCAAAAGGTAATTTATTTAAAGCGATTTTGGGTATAGGTGGCGCTGTAGCAGCTGTA
    CTTGTTACACGTAAAGATAGTCGTGACAAGCTGAAAGCAGAATATAATAAATATAAACAA
    GATCCTCAAAGCTATAAAGATAATGCTAAGGATAAAGCGACGCAATTAGGAACAATTGCT
    AATGAAACAATTAAAGAAGTAAAAACAAATCCGAAAGAATATGCTAATAGATTAAAAAAT
    AATCCAAAAGCATTTTTCGAAGAAGAAAAATCAAAATTTACCGAATATGACAATAAGACT
    GACGAAAGTATTGAAAAAGGTAAATTTGATGATGAAGGTGGCGCCGCACCAAATAATAAT
    TTACGTATCGTCACTGAAGAAGACTTAAAAAAGAATAAAAATGCACTATCTGATAAAGAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    423

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001742 [new locus tag: EGJ38_RS08700 ]
  • symbol: EGJ38_001742
  • description: YtxH domain-containing protein
  • length: 140
  • theoretical pI: 9.49093
  • theoretical MW: 15734.5
  • GRAVY: -1.15

Function[edit | edit source]

  • TIGRFAM:
    two transmembrane protein (TIGR04527; HMM-score: 18.5)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined YtxH; YtxH-like protein (PF12732; HMM-score: 24.3)
    and 2 more
    SOGA; Protein SOGA (PF11365; HMM-score: 11.1)
    TMPIT; TMPIT-like protein (PF07851; HMM-score: 8.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0032
    • Cytoplasmic Membrane Score: 0.6967
    • Cell wall & surface Score: 0.126
    • Extracellular Score: 0.1742
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.307563
    • TAT(Tat/SPI): 0.078886
    • LIPO(Sec/SPII): 0.117906
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423698 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MAKGNLFKAILGIGGAVAAVLVTRKDSRDKLKAEYNKYKQDPQSYKDNAKDKATQLGTIANETIKEVKTNPKEYANRLKNNPKAFFEEEKSKFTEYDNKTDESIEKGKFDDEGGAAPNNNLRIVTEEDLKKNKNALSDKE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: SarA/JSNZ_000585 regulon, SigB/JSNZ_002025 (activation) regulon
    SarA/JSNZ_000585(TF)important in Virulence;  [2] [3]
    SigB/JSNZ_002025(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [4] [5] [6]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Kristen M Sterba, Samuel G Mackintosh, Jon S Blevins, Barry K Hurlburt, Mark S Smeltzer
    Characterization of Staphylococcus aureus SarA binding sites.
    J Bacteriol: 2003, 185(15);4410-7
    [PubMed:12867449] [WorldCat.org] [DOI] (P p)
  3. Yingfang Liu, Adhar C Manna, Cheol-Ho Pan, Irina A Kriksunov, Daniel J Thiel, Ambrose L Cheung, Gongyi Zhang
    Structural and function analyses of the global regulatory protein SarA from Staphylococcus aureus.
    Proc Natl Acad Sci U S A: 2006, 103(7);2392-7
    [PubMed:16455801] [WorldCat.org] [DOI] (P p)
  4. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  5. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  6. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]