From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0424 [new locus tag: SA_RS02415 ]
  • symbol: SA0424
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 486130..486408
  • length: 279
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATTATTATTATGGCAAAACGTTCCAAATCACAACGTTTATCAAGTTTACTAAATGTCGCA
    GGTTTCATAGTCGACGGCTACAATGGCTATAAATATCATGCTAAAAATAAAAAATTAGTA
    TATCTTTCATTAGGTTTAAGCACTGTAGGAACCGTGTTAGACTTTTACATTTCAATTAAG
    TCACCACGTAAGTTCAAAAAAGCAGTGGCAGTTGTTACTTTAATAACAAACGGTGCTAGA
    TTATTTACAAGCATTCGCAAAGTAAAGCATGAATACTAA
    60
    120
    180
    240
    279

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0424 [new locus tag: SA_RS02415 ]
  • symbol: SA0424
  • description: hypothetical protein
  • length: 92
  • theoretical pI: 11.0199
  • theoretical MW: 10356.3
  • GRAVY: 0.075

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Uncharacterized protein SERP0102
  • PFAM:
    no clan defined ATP-synt_Z; Putative AtpZ or ATP-synthase-associated (PF16594; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0042
    • Cytoplasmic Membrane Score: 0.7311
    • Cell wall & surface Score: 0.0047
    • Extracellular Score: 0.26
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013849
    • TAT(Tat/SPI): 0.003218
    • LIPO(Sec/SPII): 0.009073
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIIMAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLSTVGTVLDFYISIKSPRKFKKAVAVVTLITNGARLFTSIRKVKHEY

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]