Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08085 [old locus tag: NWMN_1432 ]
  • pan locus tag?: SAUPAN004082000
  • symbol: NWMN_RS08085
  • pan gene symbol?: accB
  • synonym:
  • product: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS08085 [old locus tag: NWMN_1432 ]
  • symbol: NWMN_RS08085
  • product: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 1603482..1603946
  • length: 465
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_009641 (1603482..1603946) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1432

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAACTTTAAAGAAATCAAAGAATTAATTGAAATTCTGGATAAATCAACTTTAACGGAA
    ATCAATATTGAAGATACTAAAGGCAAAGTGACGCTTAAGAAAGAAAAAGAAACTGAGATT
    ATCACGCCACAAATCTCACAAATGCCAGTTGAAGCTGCGGCAATGCCTATGCCTCAAGCA
    CAATCAACTGATAGCAATAAAACTGAAGCTCCAAAGCCAACTTCAGATAATCACAAAACA
    ATTAATGCACCTATGGTAGGTACATTTTACAAATCGCCATCTCCAGACGAAGAAGCATAT
    GTGCAAGTTGGGGACACTGTTTCAAATGAAACAACAGTGTGTATTTTAGAGGCAATGAAA
    CTATTTAATGAAATTCAAGCAGAAATTTCAGGTGAAATTGTTGAAATCTTAGTAGAAGAC
    GGACAAATGGTAGAGTATGGCCAACCGTTATTTAAGGTGAAATAA
    60
    120
    180
    240
    300
    360
    420
    465

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_RS08085 [old locus tag: NWMN_1432 ]
  • symbol: NWMN_RS08085
  • description: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
  • length: 154
  • theoretical pI: 4.2253
  • theoretical MW: 17121.4
  • GRAVY: -0.423377

⊟Function[edit | edit source]

  • ⊞TIGRFAM:
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis acetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 170.6)
    and 16 more
    Metabolism Central intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 39.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 38.5)
    Metabolism Energy metabolism Other oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 38.5)
    Metabolism Energy metabolism Pyruvate dehydrogenase dihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 31.1)
    Metabolism Energy metabolism Glycolysis/gluconeogenesis pyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 30.1)
    Metabolism Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 22.2)
    Metabolism Transport and binding proteins Unknown substrate efflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 22)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 16.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 16.3)
    Metabolism Transport and binding proteins Other efflux pump membrane protein (TIGR00998; HMM-score: 15)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 14.9)
    Cell structure Cell envelope Other uncharacterized lipoprotein (TIGR02722; HMM-score: 14.7)
    glycine cleavage protein H-like protein (TIGR03077; HMM-score: 13.7)
    Metabolism Energy metabolism Amino acids and amines glycine cleavage system H protein (TIGR00527; HMM-score: 13.3)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair UV excision repair protein Rad23 (TIGR00601; HMM-score: 13)
    2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (TIGR02927; EC 2.3.1.61; HMM-score: 10.2)
  • TheSEED: see NWMN_1432
  • ⊞PFAM:
    Hybrid (CL0105) Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 81.7)
    and 7 more
    Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 30.2)
    GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 18.6)
    HlyD_3; HlyD family secretion protein (PF13437; HMM-score: 17.5)
    no clan defined EPL1; Enhancer of polycomb-like (PF10513; HMM-score: 15)
    Hybrid (CL0105) HlyD_D23; Barrel-sandwich domain of CusB or HlyD membrane-fusion (PF16576; HMM-score: 14.2)
    no clan defined PCM1_C; Pericentriolar material 1 C terminus (PF15717; HMM-score: 13.2)
    Dicty_REP; Dictyostelium (Slime Mold) REP protein (PF05086; HMM-score: 11.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9914
    • Cytoplasmic Membrane Score: 0.0044
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0039
  • LocateP:
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.063844
    • TAT(Tat/SPI): 0.002354
    • LIPO(Sec/SPII): 0.001119
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 446932260 NCBI
  • RefSeq: WP_001009516 NCBI
  • UniProt: see NWMN_1432

⊟Protein sequence[edit | edit source]

  • MNFKEIKELIEILDKSTLTEINIEDTKGKVTLKKEKETEIITPQISQMPVEAAAMPMPQAQSTDSNKTEAPKPTSDNHKTINAPMVGTFYKSPSPDEEAYVQVGDTVSNETTVCILEAMKLFNEIQAEISGEIVEILVEDGQMVEYGQPLFKVK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: no data available

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_RS08085&oldid=72928"
  • This page was last edited on 10 March 2016, at 22:00.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X