Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1572 [new locus tag: SACOL_RS08005 ]
- pan locus tag?: SAUPAN004082000
- symbol: accB
- pan gene symbol?: accB
- synonym:
- product: acetyl-CoA carboxylase, biotin carboxyl carrier protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1572 [new locus tag: SACOL_RS08005 ]
- symbol: accB
- product: acetyl-CoA carboxylase, biotin carboxyl carrier protein
- replicon: chromosome
- strand: -
- coordinates: 1607302..1607766
- length: 465
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236296 NCBI
- RefSeq: YP_186413 NCBI
- BioCyc: see SACOL_RS08005
- MicrobesOnline: 913021 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAACTTTAAAGAAATCAAAGAATTAATTGAAATTCTGGATAAATCAACTTTAACGGAA
ATCAATATTGAAGATACTAAAGGCAAAGTGACGCTTAAGAAAGAAAAAGAAACTGAGATT
ATCACGCCACAAATCTCACAAATGCCAGTTGAAGCTGCGGCAATGCCTATGCCTCAAGCA
CAATCAACTGATAGCAATAAAACTGAAGCTCCAAAGCCAACTTCAGATAATCACAAAACA
ATTAATGCACCTATGGTAGGTACATTTTACAAATCGCCATCTCCAGACGAAGAAGCATAT
GTGCAAGTTGGGGACACTGTTTCAAATGAAACAACAGTGTGTATTTTAGAGGCAATGAAA
CTATTTAATGAAATTCAAGCAGAAATTTCAGGTGAAATTGTTGAAATCTTAGTAGAAGAC
GGACAAATGGTAGAGTATGGCCAACCGTTATTTAAGGTGAAATAA60
120
180
240
300
360
420
465
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1572 [new locus tag: SACOL_RS08005 ]
- symbol: AccB
- description: acetyl-CoA carboxylase, biotin carboxyl carrier protein
- length: 154
- theoretical pI: 4.2253
- theoretical MW: 17121.4
- GRAVY: -0.423377
⊟Function[edit | edit source]
- TIGRFAM: Fatty acid and phospholipid metabolism Biosynthesis acetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 170.6)and 16 moreCentral intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 39.4)Transport and binding proteins Cations and iron carrying compounds oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 38.5)Energy metabolism Other oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 38.5)Energy metabolism Pyruvate dehydrogenase dihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 31.1)Energy metabolism Glycolysis/gluconeogenesis pyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 30.1)Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 22.2)Transport and binding proteins Unknown substrate efflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 22)Cellular processes Biosynthesis of natural products NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 16.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 16.3)Transport and binding proteins Other efflux pump membrane protein (TIGR00998; HMM-score: 15)Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 14.9)Cell envelope Other uncharacterized lipoprotein (TIGR02722; HMM-score: 14.7)glycine cleavage protein H-like protein (TIGR03077; HMM-score: 13.7)Energy metabolism Amino acids and amines glycine cleavage system H protein (TIGR00527; HMM-score: 13.3)DNA metabolism DNA replication, recombination, and repair UV excision repair protein Rad23 (TIGR00601; HMM-score: 13)2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (TIGR02927; EC 2.3.1.61; HMM-score: 10.2)
- TheSEED :
- Biotin carboxyl carrier protein of acetyl-CoA carboxylase
Fatty Acids, Lipids, and Isoprenoids Fatty acids Fatty Acid Biosynthesis FASII Biotin carboxyl carrier protein of acetyl-CoA carboxylaseand 1 more - PFAM: Hybrid (CL0105) Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 81.7)and 7 moreBiotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 30.2)GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 18.6)HlyD_3; HlyD family secretion protein (PF13437; HMM-score: 17.5)no clan defined EPL1; Enhancer of polycomb-like (PF10513; HMM-score: 15)Hybrid (CL0105) HlyD_D23; Barrel-sandwich domain of CusB or HlyD membrane-fusion (PF16576; HMM-score: 14.2)no clan defined PCM1_C; Pericentriolar material 1 C terminus (PF15717; HMM-score: 13.2)Dicty_REP; Dictyostelium (Slime Mold) REP protein (PF05086; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9914
- Cytoplasmic Membrane Score: 0.0044
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0039
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.063844
- TAT(Tat/SPI): 0.002354
- LIPO(Sec/SPII): 0.001119
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNFKEIKELIEILDKSTLTEINIEDTKGKVTLKKEKETEIITPQISQMPVEAAAMPMPQAQSTDSNKTEAPKPTSDNHKTINAPMVGTFYKSPSPDEEAYVQVGDTVSNETTVCILEAMKLFNEIQAEISGEIVEILVEDGQMVEYGQPLFKVK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 1418 [5]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: FapR* (repression) regulon
FapR* (TF) important in Fatty acid biosynthesis; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 18.43 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)