⊟Summary[edit | edit source]

PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

⊟Summary

• organism: Staphylococcus aureus COL
locus tag: SACOL1998 [new locus tag: SACOL_RS10440 ]
pan locus tag^?: SAUPAN005001000
symbol: SACOL1998
pan gene symbol^?: —
• synonym:
• product: hypothetical protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SACOL1998 [new locus tag: SACOL_RS10440 ]
• symbol: SACOL1998
• product: hypothetical protein
• replicon: chromosome
• strand: -
• coordinates: 2058955..2059131
• length: 177
• essential: unknown other strains

⊟Accession numbers

• Gene ID: 3238639 NCBI
• RefSeq: YP_186822 NCBI
• BioCyc: see SACOL_RS10440
• MicrobesOnline: 913476 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  
  TTGAAACATCTAACAAAAATATTTGTAGTACTTGCAATTATTTTATTTATTATTGGTTAT
  TATTTACAAGCAACTAATCATGAAAGCCAAGGTATAAAATTATTATTAGCAGCGATTATG
  TTTATGATTTGTGCTTTTATAAGTAGAAGTAATGATCGACGTAAAAATAGTAAATAG
  60
  120
  177
  

⊟Protein

⊟General

• locus tag: SACOL1998 [new locus tag: SACOL_RS10440 ]
• symbol: SACOL1998
• description: hypothetical protein
• length: 58
• theoretical pI: 10.7419
• theoretical MW: 6685.08
• GRAVY: 0.551724

⊟Function

• ⊞⊞TIGRFAM:
  Hypothetical proteins Conserved TIGR00245 family protein (TIGR00245; HMM-score: 18.3)
  and 1 more
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides oligosaccharide repeat unit polymerase (TIGR04370; HMM-score: 13.4)
• TheSEED  :
  • FIG01107851: hypothetical protein
• ⊞⊞PFAM:
  no clan defined DUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 22.5)
  and 17 more
  ABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 17.4)
  CopD_like (CL0430) DUF1516; Protein of unknown function (DUF1516) (PF07457; HMM-score: 16.8)
  no clan defined YesK; YesK-like protein (PF14150; HMM-score: 16.5)
  TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 15.7)
  Hypoth_1 (CL0447) DUF3784; Domain of unknown function (DUF3784) (PF12650; HMM-score: 15.5)
  Acyl_transf_3 (CL0316) Acyl_transf_3; Acyltransferase domain (PF01757; HMM-score: 15.1)
  no clan defined DUF7649; Domain of unknown function (DUF7649) (PF24661; HMM-score: 15.1)
  DUF131; Protein of unknown function DUF131 (PF01998; HMM-score: 14)
  RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 13.8)
  Cyt_c_ox_IV; Cytochrome c oxidase subunit IV (PF12270; HMM-score: 13.8)
  MFS (CL0015) MFS_1; Major Facilitator Superfamily (PF07690; HMM-score: 13.3)
  no clan defined FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 12.4)
  DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 12.3)
  ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 11.9)
  NVEALA; NVEALA protein (PF14055; HMM-score: 10.8)
  DUF6903; Family of unknown function (DUF6903) (PF21844; HMM-score: 8.8)
  SPC12; Microsomal signal peptidase 12 kDa subunit (SPC12) (PF06645; HMM-score: 8.7)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• ⊞⊞PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.32
  • Cytoplasmic Membrane Score: 9.55
  • Cellwall Score: 0.12
  • Extracellular Score: 0.01
  • Internal Helices: 2
• ⊞⊞DeepLocPro: Cytoplasmic Membrane
  • Cytoplasmic Score: 0
  • Cytoplasmic Membrane Score: 0.9781
  • Cell wall & surface Score: 0.0001
  • Extracellular Score: 0.0218
• ⊞⊞LocateP: Multi-transmembrane
  • Prediction by SwissProt Classification: Membrane
  • Pathway Prediction: Sec-(SPI)
  • Intracellular possibility: 0.17
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: 1
  • Predicted Cleavage Site: No CleavageSite
• ⊞⊞SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.082012
  • TAT(Tat/SPI): 0.001183
  • LIPO(Sec/SPII): 0.06066
• predicted transmembrane helices (TMHMM): 2

⊟Accession numbers

• GI: 57650688 NCBI
• RefSeq: YP_186822 NCBI
• UniProt: A0A0H2WX75 UniProt

⊟Protein sequence

• MKHLTKIFVVLAIILFIIGYYLQATNHESQGIKLLLAAIMFMICAFISRSNDRRKNSK

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: no polycistronic organisation predicted

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊞Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊞Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications