Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1567 [new locus tag: SACOL_RS07980 ]
- pan locus tag?: SAUPAN004077000
- symbol: xseB
- pan gene symbol?: xseB
- synonym:
- product: exodeoxyribonuclease VII small subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1567 [new locus tag: SACOL_RS07980 ]
- symbol: xseB
- product: exodeoxyribonuclease VII small subunit
- replicon: chromosome
- strand: -
- coordinates: 1603544..1603774
- length: 231
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237334 NCBI
- RefSeq: YP_186408 NCBI
- BioCyc: see SACOL_RS07980
- MicrobesOnline: 913016 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACTAAAGAAACGCAAAGTTTTGAAGAAATGATGCAAGAATTAGAGCAAATTGTTCAA
AAATTAGATAATGAAACAGTATCTTTAGAGGAATCATTAGATTTATATCAACGTGGTATG
AAACTATCAGCAGCTTGTGACACAACTTTAAAAAATGCCGAAAAAAAGGTGAATGACTTA
ATAAAAGAAGAAGCTGAGGATGTAAAAAATGACGAATCTACCGATGAATAA60
120
180
231
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1567 [new locus tag: SACOL_RS07980 ]
- symbol: XseB
- description: exodeoxyribonuclease VII small subunit
- length: 76
- theoretical pI: 3.9341
- theoretical MW: 8759.64
- GRAVY: -0.977632
⊟Function[edit | edit source]
- ⊞reaction: EC 3.1.11.6? ExPASy
- ⊞TIGRFAM: DNA metabolism Degradation of DNA exodeoxyribonuclease VII, small subunit (TIGR01280; EC 3.1.11.6; HMM-score: 81)and 2 more
- TheSEED :
- Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)
- ⊞PFAM: no clan defined Exonuc_VII_S; Exonuclease VII small subunit (PF02609; HMM-score: 75.8)and 12 more
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKETQSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDLIKEEAEDVKNDESTDE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell: 536 [2]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)