From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS018 [new locus tag: SA_RS04270 ]
  • pan locus tag?: SAUPAN002806000
  • symbol: SAS018
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAS018 [new locus tag: SA_RS04270 ]
  • symbol: SAS018
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 858892..859080
  • length: 189
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACG
    TTTATACTCGTATTAATGAAAAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGT
    TTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAATATACACATTTATATTTGGT
    GTGCTATAA
    60
    120
    180
    189

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAS018 [new locus tag: SA_RS04270 ]
  • symbol: SAS018
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.0084
  • theoretical MW: 7142.76
  • GRAVY: 1.46613

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01107975: hypothetical protein
  • ⊞PFAM:
    no clan defined MRAP; Melanocortin-2 receptor accessory protein family (PF15183; HMM-score: 16.5)
    BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 16)
    and 11 more
    DUF805; Protein of unknown function (DUF805) (PF05656; HMM-score: 12.7)
    PGG; Domain of unknown function (PF13962; HMM-score: 12.5)
    DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 12.3)
    TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 9.3)
    no clan defined CcmH; Cytochrome C biogenesis protein (PF03918; HMM-score: 9.1)
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 9.1)
    TRAP (CL0757) LAX; Lymphocyte activation family X (PF15681; HMM-score: 8.9)
    no clan defined DUF2208; Predicted membrane protein (DUF2208) (PF09973; HMM-score: 8.7)
    DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 8.6)
    Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 7.8)
    no clan defined DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 7.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • ⊞DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9985
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0015
  • ⊞LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008667
    • TAT(Tat/SPI): 0.00071
    • LIPO(Sec/SPII): 0.122172
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAS018&oldid=101113"