From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00823
  • pan locus tag?: SAUPAN002806000
  • symbol: SAOUHSC_00823
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00823
  • symbol: SAOUHSC_00823
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 803182..803370
  • length: 189
  • essential: no [1] DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACG
    TTTATACTCGTATTAATGAAAAAAACTAGCAAAGAATCTAAAAAAGAGTCCTATTTAAGT
    TTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAATATACACATTTATATTTGGT
    GTGCTATAA
    60
    120
    180
    189

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00823
  • symbol: SAOUHSC_00823
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.0084
  • theoretical MW: 7172.78
  • GRAVY: 1.45968

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01107975: hypothetical protein
  • PFAM:
    no clan defined DUF7649; Domain of unknown function (DUF7649) (PF24661; HMM-score: 15.2)
    BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 15.1)
    YwiC; YwiC-like protein (PF14256; HMM-score: 13.7)
    DUF202; Domain of unknown function (DUF202) (PF02656; HMM-score: 13)
    DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 12.8)
    DUF6814; Family of unknown function (DUF6814) (PF20664; HMM-score: 12.8)
    DUF805; Protein of unknown function (DUF805) (PF05656; HMM-score: 12.7)
    PGG; Domain of unknown function (PF13962; HMM-score: 12.3)
    and 11 more
    SLC3A2_N; Solute carrier family 3 member 2 N-terminus (PF16028; HMM-score: 12.1)
    MRAP; Melanocortin-2 receptor accessory protein family (PF15183; HMM-score: 12)
    TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 10.3)
    no clan defined CcmH; Cytochrome C biogenesis protein (PF03918; HMM-score: 10.1)
    TRAP (CL0757) SIT; SHP2-interacting transmembrane adaptor protein, SIT (PF15330; HMM-score: 10.1)
    no clan defined DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 9.5)
    DUF2208; Predicted membrane protein (DUF2208) (PF09973; HMM-score: 9.4)
    TRAP (CL0757) LAX; Lymphocyte activation family X (PF15681; HMM-score: 9.2)
    Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 8.4)
    no clan defined DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 8.3)
    DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 7.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9976
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0024
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009265
    • TAT(Tat/SPI): 0.000756
    • LIPO(Sec/SPII): 0.123344
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. ↑ 2.0 2.1 2.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_00823&oldid=85873"