Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS04270 [old locus tag: SAS018 ]
- pan locus tag?: SAUPAN002806000
- symbol: SA_RS04270
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACG
TTTATACTCGTATTAATGAAAAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGT
TTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAATATACACATTTATATTTGGT
GTGCTATAA60
120
180
189
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS04270 [old locus tag: SAS018 ]
- symbol: SA_RS04270
- description: hypothetical protein
- length: 62
- theoretical pI: 10.0084
- theoretical MW: 7142.76
- GRAVY: 1.46613
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAS018
- PFAM: no clan defined MRAP; Melanocortin-2 receptor accessory protein family (PF15183; HMM-score: 16.5)BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 16)and 11 moreDUF805; Protein of unknown function (DUF805) (PF05656; HMM-score: 12.7)PGG; Domain of unknown function (PF13962; HMM-score: 12.5)DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 12.3)TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 9.3)no clan defined CcmH; Cytochrome C biogenesis protein (PF03918; HMM-score: 9.1)DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 9.1)TRAP (CL0757) LAX; Lymphocyte activation family X (PF15681; HMM-score: 8.9)no clan defined DUF2208; Predicted membrane protein (DUF2208) (PF09973; HMM-score: 8.7)DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 8.6)Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 7.8)no clan defined DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 7.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9985
- Cell wall & surface Score: 0
- Extracellular Score: 0.0015
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008667
- TAT(Tat/SPI): 0.00071
- LIPO(Sec/SPII): 0.122172
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]