NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

organism: Staphylococcus aureus COL

locus tag: SACOL_RS06405 [old locus tag: SACOL1254 ]

pan locus tag^?: SAUPAN003527000

symbol: SACOL_RS06405

pan gene symbol^?: rpsP

synonym:
product: 30S ribosomal protein S16

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

type: CDS
locus tag: SACOL_RS06405 [old locus tag: SACOL1254 ]
symbol: SACOL_RS06405
product: 30S ribosomal protein S16
replicon: chromosome
strand: +
coordinates: 1263501..1263776
length: 276
essential: unknown other strains

⊟Accession numbers[edit | edit source]

Location: NC_002951 (1263501..1263776) NCBI
BioCyc: SACOL_RS06405 BioCyc
MicrobesOnline: see SACOL1254

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

1
61
121
181
241
ATGGCAGTTAAAATTCGTTTAACACGTTTAGGTTCAAAAAGAAATCCATTCTATCGTATC
GTAGTAGCAGATGCTCGTTCTCCACGTGACGGACGTATCATCGAACAAATCGGTACTTAT
AACCCAACGAGCGCTAATGCTCCAGAAATTAAAGTTGACGAAGCGTTAGCTTTAAAATGG
TTAAATGATGGTGCGAAACCAACTGATACAGTTCACAATATCTTATCAAAAGAAGGTATT
ATGAAAAAATTTGACGAACAAAAGAAAGCTAAGTAA
60
120
180
240
276

⊟Protein[edit | edit source]

⊟General[edit | edit source]

locus tag: SACOL_RS06405 [old locus tag: SACOL1254 ]
symbol: SACOL_RS06405
description: 30S ribosomal protein S16
length: 91
theoretical pI: 10.6208
theoretical MW: 10234.8
GRAVY: -0.608791

⊟Function[edit | edit source]

TIGRFAM:
Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS16 (TIGR00002; HMM-score: 111.3)
TheSEED: see SACOL1254
PFAM:
no clan defined Ribosomal_S16; Ribosomal protein S16 (PF00886; HMM-score: 89.5)

⊟Structure, modifications & cofactors[edit | edit source]

domains:
modifications:
cofactors:
effectors:

⊟Localization[edit | edit source]

⊞⊞
PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
⊞⊞
DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5918
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.4079
LocateP:
⊞⊞
SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009549
- TAT(Tat/SPI): 0.000637
- LIPO(Sec/SPII): 0.001934
predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

GI: 446190899 NCBI
RefSeq: WP_000268754 NCBI
UniProt: see SACOL1254

⊟Protein sequence[edit | edit source]

MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKKAK

⊟Experimental data[edit | edit source]

experimentally validated: see SACOL1254
protein localization: see SACOL1254
quantitative data / protein copy number per cell: see SACOL1254

⊟⊟interaction partners:

SACOL_RS01040		formate acetyltransferase ^[1] (data from MRSA252)
SACOL_RS02330		IMP dehydrogenase ^[1] (data from MRSA252)
SACOL_RS03035		50S ribosomal protein L10 ^[1] (data from MRSA252)
SACOL_RS03080		elongation factor Tu ^[1] (data from MRSA252)
SACOL_RS04310		aldehyde dehydrogenase ^[1] (data from MRSA252)
SACOL_RS05630		pyruvate dehydrogenase E1 component subunit alpha ^[1] (data from MRSA252)
SACOL_RS11010		uracil phosphoribosyltransferase ^[1] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

regulator:

⊟Transcription pattern[edit | edit source]

S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

Aureolib: no data available

⊟Protein stability[edit | edit source]

half-life: no data available

⊞Biological Material[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

↑ ^{Jump up to: 1.0} ^1.1 ^1.2 ^1.3 ^1.4 ^1.5 ^1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

[pubmed21166474-1] {Jump up to: 1.0} ^1.1 ^1.2 ^1.3 ^1.4 ^1.5 ^1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)

[1]

Search

Navigation menu

Links

⊟Summary[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟DNA sequence[edit | edit source]

⊟Protein[edit | edit source]

⊟General[edit | edit source]

⊟Function[edit | edit source]

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

⊟Summary[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟DNA sequence[edit | edit source]

⊟Protein[edit | edit source]

⊟General[edit | edit source]

⊟Function[edit | edit source]

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]