From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS04890 [old locus tag: SA0864 ]
  • symbol: SA_RS04890
  • product: GTP pyrophosphokinase
  • replicon: chromosome
  • strand: +
  • coordinates: 978184..978819
  • length: 636
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (978184..978819) NCBI
  • BioCyc: SA_RS04890 BioCyc
  • MicrobesOnline: see SA0864

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAATCAATGGGATCAGTTCTTAACACCTTATAAGCAAGCGGTTGATGAGTTGAAAGTG
    AAACTTAAAGGCATGCGCAAACAATATGAAGTTGGTGAACAAGCGTCGCCAATAGAATTT
    GTTACTGGTCGTGTTAAACCGATCGCTAGTATTATAGATAAGGCAAACAAACGACAAATA
    CCATTTGATAGGTTAAGAGAAGAAATGTACGATATCGCTGGTTTAAGAATGATGTGCCAA
    TTTGTAGAAGATATTGATGTTGTCGTCAATATTTTAAGACAAAGAAAAGATTTTAAAGTA
    ATTGAAGAACGAGATTATATTCGTAACACTAAAGAAAGTGGTTACCGCTCGTATCATGTC
    ATTATTGAATATCCAATTGAAACATTACAAGGCCAAAAATTTATATTGGCTGAGATTCAG
    ATTCGTACATTAGCAATGAATTTCTGGGCAACGATTGAACATACTTTACGATATAAATAT
    GATGGTGCTTATCCGGATGAAATTCAACATCGTTTGGAAAGAGCGGCAGAAGCAGCGTAT
    TTACTTGATGAAGAGATGTCTGAAATTAAAGATGAAATTCAGGAAGCTCAAAAATATTAC
    ACGCAAAAACGTTCTAAAAAACATGAAAATGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    636

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS04890 [old locus tag: SA0864 ]
  • symbol: SA_RS04890
  • description: GTP pyrophosphokinase
  • length: 211
  • theoretical pI: 6.16491
  • theoretical MW: 25238.7
  • GRAVY: -0.72654

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Adaptations to atypical conditions RelA/SpoT family protein (TIGR00691; HMM-score: 36)
  • TheSEED: see SA0864
  • PFAM:
    NTP_transf (CL0260) RelA_SpoT; Region found in RelA / SpoT proteins (PF04607; HMM-score: 120.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9848
    • Cytoplasmic Membrane Score: 0.0074
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0076
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003537
    • TAT(Tat/SPI): 0.000394
    • LIPO(Sec/SPII): 0.000728
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNQWDQFLTPYKQAVDELKVKLKGMRKQYEVGEQASPIEFVTGRVKPIASIIDKANKRQIPFDRLREEMYDIAGLRMMCQFVEDIDVVVNILRQRKDFKVIEERDYIRNTKESGYRSYHVIIEYPIETLQGQKFILAEIQIRTLAMNFWATIEHTLRYKYDGAYPDEIQHRLERAAEAAYLLDEEMSEIKDEIQEAQKYYTQKRSKKHEND

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Tobias Geiger, Benjamin Kästle, Fabio Lino Gratani, Christiane Goerke, Christiane Wolz
Two small (p)ppGpp synthases in Staphylococcus aureus mediate tolerance against cell envelope stress conditions.
J Bacteriol: 2014, 196(4);894-902
[PubMed:24336937] [WorldCat.org] [DOI] (I p)