PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Views

• Read
• Edit
• History

More

• Edit source

⊟Summary

• organism: Staphylococcus aureus N315
locus tag: SA2002 [new locus tag: SA_RS11525 ]
pan locus tag^?: SAUPAN005608000
symbol: SA2002
pan gene symbol^?: —
• synonym:
• product: hypothetical protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SA2002 [new locus tag: SA_RS11525 ]
• symbol: SA2002
• product: hypothetical protein
• replicon: chromosome
• strand: -
• coordinates: 2272769..2273185
• length: 417
• essential: no DEG other strains

⊟Accession numbers

• Gene ID: 1124919 NCBI
• RefSeq: NP_375314 NCBI
• BioCyc: see SA_RS11525
• MicrobesOnline: 104340 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  
  ATGAAAACTAAAGAAGTCGTAGCGCTCATGAATATATCTCAAGACACTTTAAGATATTAT
  GAAAAGGTTGGTGTGATTCCACCCGTTAATCGAGATGAAAATGGATATAGAATATATAAT
  GATAGTGATTTAAATTGGATTTATTTAGTGAAAAATTTGCGAAATGCAGGCGTCAGTATT
  GAATCGCTTATCGAATTTTGTAGATTAGCGCAGCTTCCTAAAAATAAAAATATTCAAACA
  CAGCAAAAGCAAATTTTAAATAAGCAACTCGAAGAATTAAATGAAAACTTAAAGACAATT
  CATGATGCGAGAGATTTACTAAAATATAAAATTGATAATTATGATAATCATATTGCTAAA
  ATCAATGCTAGTGATAATCATGATGACAATGTTGAACGTCTTTGGGAGAGAAAGTAA
  60
  120
  180
  240
  300
  360
  417
  

⊟Protein

⊟General

• locus tag: SA2002 [new locus tag: SA_RS11525 ]
• symbol: SA2002
• description: hypothetical protein
• length: 138
• theoretical pI: 7.59288
• theoretical MW: 16343.4
• GRAVY: -0.818841

⊟Function

• ⊞TIGRFAM:
  Signal transduction Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 63)
  Signal transduction Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 58.5)
  and 5 more
  Signal transduction Regulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 44.5)
  Cellular processes Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43)
  Signal transduction Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43)
  Cellular processes Cellular processes Detoxification mercuric resistence transcriptional repressor protein MerD (TIGR02054; HMM-score: 28.8)
  Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12)
• TheSEED  :
  • Transcriptional regulator, MerR family
  Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Cobalt-zinc-cadmium resistance  Transcriptional regulator, MerR family
• ⊞PFAM:
  HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 61.6)
  MerR; MerR family regulatory protein (PF00376; HMM-score: 51.7)
  and 12 more
  MerR-DNA-bind; MerR, DNA binding (PF09278; HMM-score: 16)
  GME (CL0197) PAD; Protein-arginine deiminase (PAD) (PF03068; HMM-score: 14.5)
  no clan defined DUF6397; Family of unknown function (DUF6397) (PF19934; HMM-score: 14.3)
  HTH (CL0123) Rep3_C; Initiator Rep protein, WH2 (PF21205; HMM-score: 14.3)
  Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 14.2)
  Peptidase_CA (CL0125) Phytochelatin; Phytochelatin synthase (PF05023; HMM-score: 14)
  HTH (CL0123) HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 14)
  ATP-grasp (CL0179) DNA_ligase_aden; NAD-dependent DNA ligase adenylation domain (PF01653; HMM-score: 13.8)
  GT-B (CL0113) RickCE_N; RickCE N-terminal (PF22189; HMM-score: 13.1)
  no clan defined DUF5320; Family of unknown function (DUF5320) (PF17253; HMM-score: 12.9)
  Tail_Terminator (CL0691) Phage_tail_terminator_7; Bacteriophage Tail Tube Terminator Protein (PF23818; HMM-score: 12.6)
  no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 10.6)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• ⊞PSORTb: Cytoplasmic
  • Cytoplasmic Score: 7.5
  • Cytoplasmic Membrane Score: 1.15
  • Cellwall Score: 0.62
  • Extracellular Score: 0.73
  • Internal Helices: 0
• ⊞DeepLocPro: Cytoplasmic
  • Cytoplasmic Score: 0.9496
  • Cytoplasmic Membrane Score: 0.0005
  • Cell wall & surface Score: 0.0004
  • Extracellular Score: 0.0495
• ⊞LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 1
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: 1
  • Predicted Cleavage Site: No CleavageSite
• ⊞SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.014504
  • TAT(Tat/SPI): 0.000174
  • LIPO(Sec/SPII): 0.001416
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 15927781 NCBI
• RefSeq: NP_375314 NCBI
• UniProt: A0A0H3JVF1 UniProt

⊟Protein sequence

• MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSIESLIEFCRLAQLPKNKNIQTQQKQILNKQLEELNENLKTIHDARDLLKYKIDNYDNHIAKINASDNHDDNVERLWERK

⊟Experimental data

• experimentally validated: data available for COL, NCTC8325
• protein localization: data available for COL
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SA2001 < SA2002

⊟Regulation

• ⊞regulator: CodY (repression) regulon

  CodY

  (TF)

  important in Amino acid metabolism; RegPrecise

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊞Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊞Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications