From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1754 [new locus tag: SA_RS10085 ]
  • pan locus tag?: SAUPAN005018000
  • symbol: SA1754
  • pan gene symbol?: scn
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA1754 [new locus tag: SA_RS10085 ]
  • symbol: SA1754
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2006528..2006878
  • length: 351
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAATTAGAAAATCTATACTTGCGGGAACTTTAGCAATCGTTTTAGCATCACCACTA
    GTAACTAATCTAGATAAAAATGAGGCACAAGCTAGCACAAGCTTGCCAACATCGAATGAA
    TATCAAAACGAAAAGTTAGCTAATGAATTAAAATCGTTATTAGATGAACTAAATGTTAAT
    GAATTAGCTACTGGAAGTTTAAACACTTATTATAAGCGAACTATAAAAATTTCAGGTCTA
    AAAGCAATGTATGCTCTTAAGTCAAAAGACTTTAAGAAAATGTCAGAAGCAAAATATCAA
    CTTCAAAAGATTTATAACGAAATTGACGAAGCACTAAAAAGTAAATATTAA
    60
    120
    180
    240
    300
    351

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA1754 [new locus tag: SA_RS10085 ]
  • symbol: SA1754
  • description: hypothetical protein
  • length: 116
  • theoretical pI: 9.83807
  • theoretical MW: 13052
  • GRAVY: -0.453448

⊟Function[edit | edit source]

  • TIGRFAM:
    pyrimidine 5'-nucleotidase (TIGR01993; EC 3.1.3.5; HMM-score: 13.3)
    MJ0570-related uncharacterized domain (TIGR00290; HMM-score: 13.1)
    integral membrane protein (TIGR04561; HMM-score: 12.4)
  • TheSEED  :
    • Involved in expression of fibrinogen binding protein, phage associated
  • ⊞PFAM:
    no clan defined CompInhib_SCIN; Staphylococcal complement inhibitor SCIN (PF11546; HMM-score: 188.5)
    and 4 more
    TPR (CL0020) M-HEAT_ATR; Serine/threonine-protein kinase ATR, M-HEAT region (PF25030; HMM-score: 18.6)
    no clan defined IDEAL; IDEAL domain (PF08858; HMM-score: 17)
    HUP (CL0039) Diphthami_syn_2; Diphthamide synthase (PF01902; HMM-score: 15)
    Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 13.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • ⊞DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0.0071
    • Extracellular Score: 0.9927
  • ⊞LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: NEAQASTS
  • ⊞SignalP: Signal peptide SP(Sec/SPI) length 31 aa
    • SP(Sec/SPI): 0.966405
    • TAT(Tat/SPI): 0.009268
    • LIPO(Sec/SPII): 0.009014
    • Cleavage Site: CS pos: 31-32. AQA-ST. Pr: 0.8237
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • ⊞regulator: SaeR (activation) regulon

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Suzan H M Rooijakkers, Maartje Ruyken, Anja Roos, Mohamed R Daha, Julia S Presanis, Robert B Sim, Willem J B van Wamel, Kok P M van Kessel, Jos A G van Strijp
Immune evasion by a staphylococcal complement inhibitor that acts on C3 convertases.
Nat Immunol: 2005, 6(9);920-7
[PubMed:16086019] [WorldCat.org] [DOI] (P p)

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA1754&oldid=88591"