Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1876 [new locus tag: NWMN_RS10795 ]
- pan locus tag?: SAUPAN005018000
- symbol: scn
- pan gene symbol?: scn
- synonym:
- product: complement inhibitor SCIN
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1876 [new locus tag: NWMN_RS10795 ]
- symbol: scn
- product: complement inhibitor SCIN
- replicon: chromosome
- strand: -
- coordinates: 2089433..2089783
- length: 351
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331144 NCBI
- RefSeq: YP_001332910 NCBI
- BioCyc:
- MicrobesOnline: 3707464 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAATTAGAAAATCTATACTTGCGGGAACTTTAGCAATCGTTTTAGCATCACCACTA
GTAACTAATCTAGATAAAAATGAGGCACAAGCTAGCACAAGCTTGCCAACATCGAATGAA
TATCAAAACGAAAAGTTAGCTAATGAATTAAAATCGTTATTAGATGAACTAAATGTTAAT
GAATTAGCTACTGGAAGTTTAAACACTTATTATAAGCGAACTATAAAAATTTCAGGTCAA
AAAGCAATGTATGCTCTTAAGTCAAAAGACTTTAAGAAAATGTCAGAAGCAAAATATCAA
CTTCAAAAGATTTATAACGAAATTGACGAAGCACTAAAAAGTAAATATTAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1876 [new locus tag: NWMN_RS10795 ]
- symbol: Scn
- description: complement inhibitor SCIN
- length: 116
- theoretical pI: 9.83807
- theoretical MW: 13067
- GRAVY: -0.516379
⊟Function[edit | edit source]
- TIGRFAM: integral membrane protein (TIGR04561; HMM-score: 12.8)
- TheSEED :
- Involved in expression of fibrinogen binding protein, phage associated
- PFAM: no clan defined CompInhib_SCIN; Staphylococcal complement inhibitor SCIN (PF11546; HMM-score: 186.7)and 5 moreEcoR124_C; Type I restriction and modification enzyme - subunit R C terminal (PF12008; HMM-score: 18.2)TPR (CL0020) M-HEAT_ATR; Serine/threonine-protein kinase ATR, M-HEAT region (PF25030; HMM-score: 17.9)no clan defined IDEAL; IDEAL domain (PF08858; HMM-score: 17)Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 14)HUP (CL0039) Diphthami_syn_2; Diphthamide synthase (PF01902; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0071
- Extracellular Score: 0.9928
- LocateP: Secretory(released) (with CS)
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: NEAQASTS
- SignalP: Signal peptide SP(Sec/SPI) length 31 aa
- SP(Sec/SPI): 0.966405
- TAT(Tat/SPI): 0.009268
- LIPO(Sec/SPII): 0.009014
- Cleavage Site: CS pos: 31-32. AQA-ST. Pr: 0.8237
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: SaeR (activation) regulon
SaeR (TF) important in Virulence; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]