From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS11650 [old locus tag: SAS078 ]
  • pan locus tag?: SAUPAN005679000
  • symbol: SA_RS11650
  • pan gene symbol?: rpmJ
  • synonym:
  • product: 50S ribosomal protein L36

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS11650 [old locus tag: SAS078 ]
  • symbol: SA_RS11650
  • product: 50S ribosomal protein L36
  • replicon: chromosome
  • strand: -
  • coordinates: 2296931..2297044
  • length: 114
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (2296931..2297044) NCBI
  • BioCyc: SA_RS11650 BioCyc
  • MicrobesOnline: see SAS078

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    ATGAAAGTAAGACCATCAGTAAAACCTATTTGCGAAAAATGTAAAGTCATTAAACGTAAA
    GGTAAAGTAATGGTAATTTGTGAAAATCCAAAACACAAACAAAGACAAGGTTAA
    60
    114


⊟Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

⊟General[edit | edit source]

  • locus tag: SA_RS11650 [old locus tag: SAS078 ]
  • symbol: SA_RS11650
  • description: 50S ribosomal protein L36
  • length: 37
  • theoretical pI: 11.0798
  • theoretical MW: 4305.35
  • GRAVY: -0.808108

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL36 (TIGR01022; HMM-score: 82.8)
  • TheSEED: see SAS078
  • PFAM:
    no clan defined Ribosomal_L36; Ribosomal protein L36 (PF00444; HMM-score: 73.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.2834
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.7159
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.157083
    • TAT(Tat/SPI): 0.006832
    • LIPO(Sec/SPII): 0.047312
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol Microbiol: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]