Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2216 [new locus tag: SACOL_RS11665 ]
- pan locus tag?: SAUPAN005679000
- symbol: rpmJ
- pan gene symbol?: rpmJ
- synonym:
- product: 50S ribosomal protein L36
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2216 [new locus tag: SACOL_RS11665 ]
- symbol: rpmJ
- product: 50S ribosomal protein L36
- replicon: chromosome
- strand: -
- coordinates: 2295776..2295889
- length: 114
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237566 NCBI
- RefSeq: YP_187026 NCBI
- BioCyc: see SACOL_RS11665
- MicrobesOnline: 913701 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61ATGAAAGTAAGACCATCAGTAAAACCTATTTGCGAAAAATGTAAAGTCATTAAACGTAAA
GGTAAAGTAATGGTAATTTGTGAAAATCCAAAACACAAACAAAGACAAGGTTAA60
114
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2216 [new locus tag: SACOL_RS11665 ]
- symbol: RpmJ
- description: 50S ribosomal protein L36
- length: 37
- theoretical pI: 11.0798
- theoretical MW: 4305.35
- GRAVY: -0.808108
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
Profiling the surfacome of Staphylococcus aureus.
Proteomics: 2010, 10(17);3082-96
[PubMed:20662103] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)