From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10325 [old locus tag: SAS063 ]
  • pan locus tag?: SAUPAN005109000
  • symbol: SA_RS10325
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS10325 [old locus tag: SAS063 ]
  • symbol: SA_RS10325
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2041825..2041986
  • length: 162
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (2041825..2041986) NCBI
  • BioCyc: SA_RS10325 BioCyc
  • MicrobesOnline: see SAS063

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAGTAAAACTTATAAAAGCTACCTAGTAGCAGTACTATGCTTCACAGTCTTAGCGATT
    GTACTTATGCCGTTTCTATACTTCACTACAGCATGGTCAATTGCAGGATTCGCAAGTATC
    GCAACATTCATATTCTATAAGGAATACTTTTATGAAGAATAA
    60
    120
    162


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS10325 [old locus tag: SAS063 ]
  • symbol: SA_RS10325
  • description: hypothetical protein
  • length: 53
  • theoretical pI: 6.41465
  • theoretical MW: 6200.31
  • GRAVY: 0.960377

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAS063
  • PFAM:
    no clan defined DUF1270; Protein of unknown function (DUF1270) (PF06900; HMM-score: 129.3)
    and 4 more
    EcsB; Bacterial ABC transporter protein EcsB (PF05975; HMM-score: 14.5)
    PH (CL0266) DUF2244; Integral membrane protein (DUF2244) (PF10003; HMM-score: 13.5)
    no clan defined COX4_pro_2; Bacterial aa3 type cytochrome c oxidase subunit IV (PF07835; HMM-score: 11.3)
    Ferlin_C; Ferlin C-terminus (PF16165; HMM-score: 9.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.9423
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0575
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.056089
    • TAT(Tat/SPI): 0.008022
    • LIPO(Sec/SPII): 0.053651
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSKTYKSYLVAVLCFTVLAIVLMPFLYFTTAWSIAGFASIATFIFYKEYFYEE

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]