Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS10325 [old locus tag: SAS063 ]
- pan locus tag?: SAUPAN005109000
- symbol: SA_RS10325
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS10325 [old locus tag: SAS063 ]
- symbol: SA_RS10325
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2041825..2041986
- length: 162
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAGTAAAACTTATAAAAGCTACCTAGTAGCAGTACTATGCTTCACAGTCTTAGCGATT
GTACTTATGCCGTTTCTATACTTCACTACAGCATGGTCAATTGCAGGATTCGCAAGTATC
GCAACATTCATATTCTATAAGGAATACTTTTATGAAGAATAA60
120
162
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS10325 [old locus tag: SAS063 ]
- symbol: SA_RS10325
- description: hypothetical protein
- length: 53
- theoretical pI: 6.41465
- theoretical MW: 6200.31
- GRAVY: 0.960377
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAS063
- PFAM: no clan defined DUF1270; Protein of unknown function (DUF1270) (PF06900; HMM-score: 129.3)and 4 moreEcsB; Bacterial ABC transporter protein EcsB (PF05975; HMM-score: 14.5)PH (CL0266) DUF2244; Integral membrane protein (DUF2244) (PF10003; HMM-score: 13.5)no clan defined COX4_pro_2; Bacterial aa3 type cytochrome c oxidase subunit IV (PF07835; HMM-score: 11.3)Ferlin_C; Ferlin C-terminus (PF16165; HMM-score: 9.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9423
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0575
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.056089
- TAT(Tat/SPI): 0.008022
- LIPO(Sec/SPII): 0.053651
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKTYKSYLVAVLCFTVLAIVLMPFLYFTTAWSIAGFASIATFIFYKEYFYEE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]