From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS08145 [old locus tag: SA1445 ]
  • pan locus tag?: SAUPAN004214000
  • symbol: SA_RS08145
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS08145 [old locus tag: SA1445 ]
  • symbol: SA_RS08145
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1646191..1646451
  • length: 261
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (1646191..1646451) NCBI
  • BioCyc: SA_RS08145 BioCyc
  • MicrobesOnline: see SA1445

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGAAAACTTTGATAAAACAATGAAATTCGACTATGAAGAACTTCCAACGCAAGATGTA
    AGAGATGTTTTAAATAATGTTTATCGAACATTAGATGAACGAGGATATAATGCCGTAAAC
    CAAATTGTAGGTTATTTATTATCAGGTGACCCTGCGTATATTCCACGCCAGAATGAAGCA
    AGAAATCAAATTCGTCATATTGATAGAGATGTTATTATGGAAGAACTTGTTTCTTACTAT
    TTAAAAGAGCAAAATAAATAA
    60
    120
    180
    240
    261

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS08145 [old locus tag: SA1445 ]
  • symbol: SA_RS08145
  • description: hypothetical protein
  • length: 86
  • theoretical pI: 4.49796
  • theoretical MW: 10303.4
  • GRAVY: -0.876744

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA1445
  • PFAM:
    no clan defined DUF965; Bacterial protein of unknown function (DUF965) (PF06135; HMM-score: 114.1)
    and 1 more
    4HB_MCP (CL0457) CHASE3; CHASE3 domain (PF05227; HMM-score: 13.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005329
    • TAT(Tat/SPI): 0.000569
    • LIPO(Sec/SPII): 0.00066
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MENFDKTMKFDYEELPTQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGDPAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol Microbiol: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA_RS08145&oldid=87977"