From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS06050 [old locus tag: SA1067 ]
  • pan locus tag?: SAUPAN003507000
  • symbol: SA_RS06050
  • pan gene symbol?: rpmB
  • synonym:
  • product: 50S ribosomal protein L28

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS06050 [old locus tag: SA1067 ]
  • symbol: SA_RS06050
  • product: 50S ribosomal protein L28
  • replicon: chromosome
  • strand: -
  • coordinates: 1207155..1207343
  • length: 189
  • essential: yes DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (1207155..1207343) NCBI
  • BioCyc: SA_RS06050 BioCyc
  • MicrobesOnline: see SA1067

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGGTAAACAATGTTTCGTAACAGGTCGTAAAGCTTCGACTGGTAACAGACGTTCACAC
    GCTTTAAACTCTACTAAACGTAGATGGAACGCTAACCTTCAAAAAGTTAGAATCCTAGTT
    GACGGTAAACCTAAAAAAGTTTGGGTTTCTGCACGTGCTTTAAAATCTGGTAAAGTAACT
    AGAGTTTAA
    60
    120
    180
    189


⊟Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

⊟General[edit | edit source]

  • locus tag: SA_RS06050 [old locus tag: SA1067 ]
  • symbol: SA_RS06050
  • description: 50S ribosomal protein L28
  • length: 62
  • theoretical pI: 12.7454
  • theoretical MW: 6977.18
  • GRAVY: -0.737097

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL28 (TIGR00009; HMM-score: 73.4)
  • TheSEED: see SA1067
  • PFAM:
    no clan defined Ribosomal_L28; Ribosomal L28 family (PF00830; HMM-score: 68)
    and 1 more
    Ubiquitin (CL0072) DUF348; G5-linked-Ubiquitin-like domain (PF03990; HMM-score: 13)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.2164
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.7836
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.053732
    • TAT(Tat/SPI): 0.026326
    • LIPO(Sec/SPII): 0.016121
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVTRV

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]