From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1134 [new locus tag: NWMN_RS06400 ]
  • pan locus tag?: SAUPAN003507000
  • symbol: rpmB
  • pan gene symbol?: rpmB
  • synonym:
  • product: 50S ribosomal protein L28

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1134 [new locus tag: NWMN_RS06400 ]
  • symbol: rpmB
  • product: 50S ribosomal protein L28
  • replicon: chromosome
  • strand: -
  • coordinates: 1242931..1243119
  • length: 189
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGGTAAACAATGTTTCGTAACAGGTCGTAAAGCTTCGACTGGTAACAGACGTTCACAC
    GCTTTAAACTCTACTAAACGTAGATGGAACGCTAACCTTCAAAAAGTTAGAATCCTAGTT
    GACGGTAAACCTAAAAAAGTTTGGGTTTCTGCACGTGCTTTAAAATCTGGTAAAGTAACT
    AGAGTTTAA
    60
    120
    180
    189

Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: NWMN_1134 [new locus tag: NWMN_RS06400 ]
  • symbol: RpmB
  • description: 50S ribosomal protein L28
  • length: 62
  • theoretical pI: 12.7454
  • theoretical MW: 6977.18
  • GRAVY: -0.737097

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL28 (TIGR00009; HMM-score: 73.4)
  • TheSEED  :
    • LSU ribosomal protein L28p
    • LSU ribosomal protein L28p, zinc-independent
    Protein Metabolism Protein biosynthesis Ribosome LSU bacterial  LSU ribosomal protein L28p
  • PFAM:
    no clan defined Ribosomal_L28; Ribosomal L28 family (PF00830; HMM-score: 68)
    and 1 more
    Ubiquitin (CL0072) DUF348; G5-linked-Ubiquitin-like domain (PF03990; HMM-score: 13)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.2164
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.7836
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.053732
    • TAT(Tat/SPI): 0.026326
    • LIPO(Sec/SPII): 0.016121
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVTRV

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]