Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS06005 [old locus tag: SA1058 ]
- pan locus tag?: SAUPAN003498000
- symbol: SA_RS06005
- pan gene symbol?: def2
- synonym:
- product: peptide deformylase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS06005 [old locus tag: SA1058 ]
- symbol: SA_RS06005
- product: peptide deformylase
- replicon: chromosome
- strand: +
- coordinates: 1197820..1198308
- length: 489
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGGCGATTAAAAAGTTAGTACCAGCATCGCATCCTATTTTAACGAAAAAAGCGCAAGCA
GTTAAAACATTTGATGATTCGTTAAAAAGATTATTACAAGATTTAGAAGATACAATGTAT
GCACAAGAAGCTGCTGGCTTATGTGCACCTCAAATTAATCAGTCATTGCAAGTGGCAATT
ATTGATATGGAAATGGAAGGATTATTACAACTTGTTAATCCGAAAATTATTAGTCAATCA
AATGAAACAATAACAGACTTAGAAGGTTCAATTACATTGCCAGATGTTTACGGCGAAGTG
ACAAGAAGTAAAATGATAGTTGTTGAAAGTTATGACGTCAATGGGAACAAAGTTGAACTA
ACTGCACATGAAGATGTAGCAAGAATGATTTTGCATATTATAGATCAAATGAACGGTATC
CCTTTTACAGAACGTGCGGACCGTATTTTAACAGATAAAGAAGTGGAGGCATATTTTATA
AATGACTAA60
120
180
240
300
360
420
480
489
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS06005 [old locus tag: SA1058 ]
- symbol: SA_RS06005
- description: peptide deformylase
- length: 162
- theoretical pI: 4.36649
- theoretical MW: 18101.7
- GRAVY: -0.110494
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein modification and repair peptide deformylase (TIGR00079; EC 3.5.1.88; HMM-score: 105.4)
- TheSEED: see SA1058
- PFAM: no clan defined Pep_deformylase; Polypeptide deformylase (PF01327; HMM-score: 143)and 2 more4H_Cytokine (CL0053) CNTF; Ciliary neurotrophic factor (PF01110; HMM-score: 12.8)PDDEXK (CL0236) NotI; Restriction endonuclease NotI (PF12183; HMM-score: 11.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9972
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0
- Extracellular Score: 0.0024
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009408
- TAT(Tat/SPI): 0.000392
- LIPO(Sec/SPII): 0.000424
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAIKKLVPASHPILTKKAQAVKTFDDSLKRLLQDLEDTMYAQEAAGLCAPQINQSLQVAIIDMEMEGLLQLVNPKIISQSNETITDLEGSITLPDVYGEVTRSKMIVVESYDVNGNKVELTAHEDVARMILHIIDQMNGIPFTERADRILTDKEVEAYFIND
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SA_RS11130 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SA_RS01275 formate acetyltransferase [1] (data from MRSA252) SA_RS01365 L-lactate dehydrogenase [1] (data from MRSA252) SA_RS02710 cysteine synthase [1] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [1] (data from MRSA252) SA_RS02955 elongation factor G [1] (data from MRSA252) SA_RS02960 elongation factor Tu [1] (data from MRSA252) SA_RS03915 ribonucleotide-diphosphate reductase subunit beta [1] (data from MRSA252) SA_RS04125 epimerase [1] (data from MRSA252) SA_RS04575 NADH dehydrogenase [1] (data from MRSA252) SA_RS04915 enoyl-ACP reductase [1] (data from MRSA252) SA_RS05190 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [1] (data from MRSA252) SA_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA_RS05365 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SA_RS06225 30S ribosomal protein S2 [1] (data from MRSA252) SA_RS07205 serine/threonine dehydratase [1] (data from MRSA252) SA_RS08505 aldehyde dehydrogenase [1] (data from MRSA252) SA_RS08560 pyruvate kinase [1] (data from MRSA252) SA_RS08625 universal stress protein UspA [1] (data from MRSA252) SA_RS08630 acetate kinase [1] (data from MRSA252) SA_RS08825 DUF1444 domain-containing protein [1] (data from MRSA252) SA_RS09645 glutamate-1-semialdehyde 2,1-aminomutase [1] (data from MRSA252) SA_RS10765 serine phosphatase [1] (data from MRSA252) SA_RS10945 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SA_RS11010 uracil phosphoribosyltransferase [1] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [1] (data from MRSA252) SA_RS11720 30S ribosomal protein S17 [1] (data from MRSA252) SA_RS11730 50S ribosomal protein L16 [1] (data from MRSA252) SA_RS11735 30S ribosomal protein S3 [1] (data from MRSA252) SA_RS12040 octopine dehydrogenase [1] (data from MRSA252) SA_RS12065 hypothetical protein [1] (data from MRSA252) SA_RS13340 pyruvate oxidase [1] (data from MRSA252) SA_RS13375 hydroxymethylglutaryl-CoA synthase [1] (data from MRSA252) SA_RS13920 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)