Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS00345 [old locus tag: SA0040 ]
- pan locus tag?: SAUPAN000104000
- symbol: SA_RS00345
- pan gene symbol?: mecI
- synonym:
- product: mecA-type methicillin resistance repressor MecI
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGG
ATGAAAAAATATGCAAGTGCGAATAATATAATAGAAGAAATACAAATGCAAAAGGACTGG
AGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATAAAAAGGGATTTATAGATCGT
AAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATAT
AAAACATCTAAAAACTTTATCAATAAAGTATACAAAGGCGGTTTCAATTCACTTGTCTTA
AACTTTGTAGAAAAAGAAGATCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTG
AATAAAAAATAA60
120
180
240
300
360
372
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS00345 [old locus tag: SA0040 ]
- symbol: SA_RS00345
- description: mecA-type methicillin resistance repressor MecI
- length: 123
- theoretical pI: 9.46589
- theoretical MW: 14789.9
- GRAVY: -0.74065
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 102.1)Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 102.1)and 3 moreRegulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 16.5)Regulatory functions DNA interactions phenylacetic acid degradation operon negative regulatory protein PaaX (TIGR02277; HMM-score: 16)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 14.8)
- TheSEED: see SA0040
- PFAM: HTH (CL0123) Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 130.6)and 10 moreMarR; MarR family (PF01047; HMM-score: 23.4)PaaX; PaaX-like protein (PF07848; HMM-score: 17.9)TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 17.2)no clan defined DUF3489; Protein of unknown function (DUF3489) (PF11994; HMM-score: 15.2)SRP54_N; SRP54-type protein, helical bundle domain (PF02881; HMM-score: 14.7)HTH (CL0123) Cullin_Nedd8; Cullin protein neddylation domain (PF10557; HMM-score: 14.3)Sulfolobus_pRN; Sulfolobus plasmid regulatory protein (PF05584; HMM-score: 13.5)no clan defined DUF1160; Protein of unknown function (DUF1160) (PF06648; HMM-score: 13.2)post-AAA (CL0604) Rep_fac_C; Replication factor C C-terminal domain (PF08542; HMM-score: 12.7)HTH (CL0123) LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by MecI, TF important in Penicillin and methicillin resistance: see SA0040
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009467
- TAT(Tat/SPI): 0.000301
- LIPO(Sec/SPII): 0.001842
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: MecI see SA0040
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.