⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0040 [new locus tag: SA_RS00345 ]
- pan locus tag?: SAUPAN000104000
- symbol: mecI
- pan gene symbol?: mecI
- synonym:
- product: methicillin resistance regulatory protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0040 [new locus tag: SA_RS00345 ]
- symbol: mecI
- product: methicillin resistance regulatory protein
- replicon: chromosome
- strand: +
- coordinates: 48894..49265
- length: 372
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1122814 NCBI
- RefSeq: NP_373280 NCBI
- BioCyc: see SA_RS00345
- MicrobesOnline: 102306 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGG
ATGAAAAAATATGCAAGTGCGAATAATATAATAGAAGAAATACAAATGCAAAAGGACTGG
AGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATAAAAAGGGATTTATAGATCGT
AAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATAT
AAAACATCTAAAAACTTTATCAATAAAGTATACAAAGGCGGTTTCAATTCACTTGTCTTA
AACTTTGTAGAAAAAGAAGATCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTG
AATAAAAAATAA60
120
180
240
300
360
372
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0040 [new locus tag: SA_RS00345 ]
- symbol: MecI
- description: methicillin resistance regulatory protein
- length: 123
- theoretical pI: 9.46589
- theoretical MW: 14789.9
- GRAVY: -0.74065
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 102.1)Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 102.1)and 3 moreRegulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 16.5)Regulatory functions DNA interactions phenylacetic acid degradation operon negative regulatory protein PaaX (TIGR02277; HMM-score: 16)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 14.8)
- TheSEED :
- Methicillin resistance repressor MecI
- PFAM: HTH (CL0123) Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 129.9)and 14 moreMarR; MarR family (PF01047; HMM-score: 24.6)Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 20.7)PaaX; PaaX-like protein (PF07848; HMM-score: 17.9)no clan defined SRP54_N; SRP54-type protein, helical bundle domain (PF02881; HMM-score: 17.6)HTH (CL0123) DUF4423; Domain of unknown function (DUF4423) (PF14394; HMM-score: 17.5)TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 17)DUF3489; Protein of unknown function (DUF3489) (PF11994; HMM-score: 15.4)DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 15)no clan defined CtsR_C; CtsR C-terminal dimerization domain (PF17727; HMM-score: 13.7)HTH (CL0123) Sulfolobus_pRN; Sulfolobus plasmid regulatory protein (PF05584; HMM-score: 13.5)post-AAA (CL0604) Rep_fac_C; Replication factor C C-terminal domain (PF08542; HMM-score: 13.5)HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 13.5)no clan defined AcMNPV_Ac75; Autographa californica nuclear polyhedrosis virus (AcMNPV), Ac75 (PF06648; HMM-score: 13.3)HTH (CL0123) LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors: Methicillin; Penicillin G
- genes regulated by MecI, TF important in Penicillin and methicillin resistanceRegPrecise
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9579
- Cytoplasmic Membrane Score: 0.0048
- Cell wall & surface Score: 0
- Extracellular Score: 0.0373
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009467
- TAT(Tat/SPI): 0.000301
- LIPO(Sec/SPII): 0.001842
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: MecI (repression) regulon
MecI (TF) important in Penicillin and methicillin resistance; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
T Ito, Y Katayama, K Hiramatsu
Cloning and nucleotide sequence determination of the entire mec DNA of pre-methicillin-resistant Staphylococcus aureus N315.
Antimicrob Agents Chemother: 1999, 43(6);1449-58
[PubMed:10348769] [WorldCat.org] [DOI] (P p)Raquel García-Castellanos, Aniebrys Marrero, Goretti Mallorquí-Fernández, Jan Potempa, Miquel Coll, F Xavier Gomis-Ruth
Three-dimensional structure of MecI. Molecular basis for transcriptional regulation of staphylococcal methicillin resistance.
J Biol Chem: 2003, 278(41);39897-905
[PubMed:12881514] [WorldCat.org] [DOI] (P p)Raquel García-Castellanos, Goretti Mallorquí-Fernández, Aniebrys Marrero, Jan Potempa, Miquel Coll, F Xavier Gomis-Rüth
On the transcriptional regulation of methicillin resistance: MecI repressor in complex with its operator.
J Biol Chem: 2004, 279(17);17888-96
[PubMed:14960592] [WorldCat.org] [DOI] (P p)K Hiramatsu, K Asada, E Suzuki, K Okonogi, T Yokota
Molecular cloning and nucleotide sequence determination of the regulator region of mecA gene in methicillin-resistant Staphylococcus aureus (MRSA).
FEBS Lett: 1992, 298(2-3);133-6
[PubMed:1544435] [WorldCat.org] [DOI] (P p)Martin K Safo, Qixun Zhao, Tzu-Ping Ko, Faik N Musayev, Howard Robinson, Neel Scarsdale, Andrew H-J Wang, Gordon L Archer
Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons.
J Bacteriol: 2005, 187(5);1833-44
[PubMed:15716455] [WorldCat.org] [DOI] (P p)Martin K Safo, Tzu Ping Ko, Faik N Musayev, Qixun Zhao, Andrew H J Wang, Gordon L Archer
Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec.
Acta Crystallogr Sect F Struct Biol Cryst Commun: 2006, 62(Pt 4);320-4
[PubMed:16582476] [WorldCat.org] [DOI] (I p)