Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 23-MAY-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_pUSA030027 [new locus tag: SAUSA300_RS14870 ]
- pan locus tag?:
- symbol: SAUSA300_pUSA030027
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_pUSA030027 [new locus tag: SAUSA300_RS14870 ]
- symbol: SAUSA300_pUSA030027
- product: hypothetical protein
- replicon: pUSA03
- strand: -
- coordinates: 26099..26515
- length: 417
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3912749 NCBI
- RefSeq: YP_492713 NCBI
- BioCyc: see SAUSA300_RS14870
- MicrobesOnline: 1291506 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAATAATAAATCCTAATATGCCCGAACCGTACAAATATGAAACTGATTATAGAAAC
ATACCTAGGGAATACTTAAATCCACATATTCCAAAAGGTAGAGGAATAGTTAAATGGAAC
GCATTTAAGACGATACCCCAGCAATATGAAATATTGGAACAACACATAGAAGATCAAAAT
AAAATAAATATGCCTCTATTGTCTGATGACCAGCTACAAGAAATTAATGAGAAAGTAAGT
AGTAAGATTAGTAAAAATATATTAACTGATTTAGATTACTGGAAAGACGGATATATATAT
TCGATTCAATGTTACATTAACAAAATAGATGAATTTAATGGATTTATGATTATCACTAAT
TCCAATTCAAACAATAAACTAAAAATACCTTTAAGTAGTATTGTTAGCGTACAGTAA60
120
180
240
300
360
417
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_pUSA030027 [new locus tag: SAUSA300_RS14870 ]
- symbol: SAUSA300_pUSA030027
- description: hypothetical protein
- length: 138
- theoretical pI: 6.52732
- theoretical MW: 16283.5
- GRAVY: -0.649275
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids TRAP transporter solute receptor, DctP family (TIGR00787; HMM-score: 14.6)
- TheSEED :
- FIG01108714: hypothetical protein
- PFAM: WYL (CL0654) YolD; YolD-like protein (PF08863; HMM-score: 73.7)and 2 moreP-loop_NTPase (CL0023) TrwB_AAD_bind; Type IV secretion-system coupling protein DNA-binding domain (PF10412; HMM-score: 13.6)no clan defined Cactin_mid; Conserved mid region of cactin (PF10312; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7354
- Cytoplasmic Membrane Score: 0.1922
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0721
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005168
- TAT(Tat/SPI): 0.000157
- LIPO(Sec/SPII): 0.000786
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIINPNMPEPYKYETDYRNIPREYLNPHIPKGRGIVKWNAFKTIPQQYEILEQHIEDQNKINMPLLSDDQLQEINEKVSSKISKNILTDLDYWKDGYIYSIQCYINKIDEFNGFMIITNSNSNNKLKIPLSSIVSVQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: LexA (repression) regulon
LexA (TF) important in SOS response; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.