From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS13820 [old locus tag: SAUSA300_2488 ]
  • pan locus tag?: SAUPAN006213000
  • symbol: SAUSA300_RS13820
  • pan gene symbol?: feoA
  • synonym:
  • product: ferrous iron transporter A

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS13820 [old locus tag: SAUSA300_2488 ]
  • symbol: SAUSA300_RS13820
  • product: ferrous iron transporter A
  • replicon: chromosome
  • strand: -
  • coordinates: 2689558..2689785
  • length: 228
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTTAAACATTAAAAATGGTGAAATGAATAAGGCTTATAAAATAAAGCGAATGGATATT
    GCTAATGAGAATATGTTGTATCGTCTAAGTGCCTTTGGGTTAACAGATGACGCTATCATA
    ACGATTAAACAAAAATGTTTATTTAAAGGGCCATGTATTATTGAAGTAAACGGACAACAG
    TTAAGTATTAGACATTGCGATGCTTGTTCTATTGCATTAGAAGAATAG
    60
    120
    180
    228

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_RS13820 [old locus tag: SAUSA300_2488 ]
  • symbol: SAUSA300_RS13820
  • description: ferrous iron transporter A
  • length: 75
  • theoretical pI: 7.9248
  • theoretical MW: 8491.98
  • GRAVY: -0.0906667

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAUSA300_2488
  • PFAM:
    TRB (CL0206) FeoA; FeoA domain (PF04023; HMM-score: 41.5)
    and 1 more
    no clan defined DUF116; Protein of unknown function DUF116 (PF01976; HMM-score: 14.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.055744
    • TAT(Tat/SPI): 0.000401
    • LIPO(Sec/SPII): 0.001156
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLNIKNGEMNKAYKIKRMDIANENMLYRLSAFGLTDDAIITIKQKCLFKGPCIIEVNGQQLSIRHCDACSIALEE

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAUSA300_RS13820&oldid=99151"