Jump to navigation
		Jump to search
		
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
 - locus tag: SAUSA300_RS11555 [old locus tag: SAUSA300_2098 ]
 - pan locus tag?: SAUPAN005443000
 - symbol: SAUSA300_RS11555
 - pan gene symbol?: czrA
 - synonym:
 - product: transcriptional regulator
 
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
 - locus tag: SAUSA300_RS11555 [old locus tag: SAUSA300_2098 ]
 - symbol: SAUSA300_RS11555
 - product: transcriptional regulator
 - replicon: chromosome
 - strand: +
 - coordinates: 2262084..2262404
 - length: 321
 - essential: unknown other strains
 
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2262084..2262404) NCBI
 - BioCyc: SAUSA300_RS11555 BioCyc
 - MicrobesOnline: see SAUSA300_2098
 
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTCAGAACAATATTCAGAAATAAATACAGATACATTAGAACGCGTAACTGAAATTTTC
AAGGCATTAGGCGATTACAATCGAATACGTATCATGGAATTGTTATCAGTCAGCGAAGCA
AGTGTTGGTCACATTTCACATCAATTGAATTTATCTCAATCAAATGTCTCGCACCAATTA
AAATTACTTAAAAGTGTGCATCTTGTGAAAGCAAAACGACAAGGCCAATCAATGATTTAT
TCATTAGATGACATCCACGTAGCAACTATGTTAAAGCAAGCCATACATCACGCGAATCAT
CCTAAAGAAAGTGGGTTATAA60
120
180
240
300
321 
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS11555 [old locus tag: SAUSA300_2098 ]
 - symbol: SAUSA300_RS11555
 - description: transcriptional regulator
 - length: 106
 - theoretical pI: 8.01089
 - theoretical MW: 11988.6
 - GRAVY: -0.336792
 
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 25.7)and 3 moreRNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.2)Amino acid biosynthesis Glutamate family arginine repressor (TIGR01529; HMM-score: 13.4)Regulatory functions DNA interactions arginine repressor (TIGR01529; HMM-score: 13.4)
 - TheSEED: see SAUSA300_2098
 - PFAM: HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 39.6)and 10 moreHTH_20; Helix-turn-helix domain (PF12840; HMM-score: 23.1)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 20.7)TPR (CL0020) Sec8_N; Exocyst complex component Sec8 N-terminal (PF04048; HMM-score: 16.7)HTH (CL0123) TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16)HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 15.6)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.8)no clan defined DUF7785; Domain of unknown function (DUF7785) (PF25009; HMM-score: 14.7)HTH (CL0123) TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 13.8)MarR_2; MarR family (PF12802; HMM-score: 13.1)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 12.6)
 
⊟Structure, modifications & cofactors[edit | edit source]
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
 - Cytoplasmic Membrane Score: 2.5
 - Cellwall Score: 2.5
 - Extracellular Score: 2.5
 - Internal Helices: 0
 
 - DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.982
 - Cytoplasmic Membrane Score: 0.0022
 - Cell wall & surface Score: 0.0003
 - Extracellular Score: 0.0155
 
 - LocateP:
 - SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003189
 - TAT(Tat/SPI): 0.000432
 - LIPO(Sec/SPII): 0.000309
 
 - predicted transmembrane helices (TMHMM): 0
 
⊟Accession numbers[edit | edit source]
- GI: 445925904 NCBI
 - RefSeq: WP_000003759 NCBI
 - UniProt: see SAUSA300_2098
 
⊟Protein sequence[edit | edit source]
- MSEQYSEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKESGL
 
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
 
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
 
⊟Protein stability[edit | edit source]
- half-life: no data available
 
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]