From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2098 [new locus tag: SAUSA300_RS11555 ]
  • pan locus tag?: SAUPAN005443000
  • symbol: arsR
  • pan gene symbol?: czrA
  • synonym:
  • product: ArsR family transcriptional regulator

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2098 [new locus tag: SAUSA300_RS11555 ]
  • symbol: arsR
  • product: ArsR family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 2262084..2262404
  • length: 321
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTCAGAACAATATTCAGAAATAAATACAGATACATTAGAACGCGTAACTGAAATTTTC
    AAGGCATTAGGCGATTACAATCGAATACGTATCATGGAATTGTTATCAGTCAGCGAAGCA
    AGTGTTGGTCACATTTCACATCAATTGAATTTATCTCAATCAAATGTCTCGCACCAATTA
    AAATTACTTAAAAGTGTGCATCTTGTGAAAGCAAAACGACAAGGCCAATCAATGATTTAT
    TCATTAGATGACATCCACGTAGCAACTATGTTAAAGCAAGCCATACATCACGCGAATCAT
    CCTAAAGAAAGTGGGTTATAA
    60
    120
    180
    240
    300
    321


⊟Protein[edit | edit source]

Protein Data Bank: 4GGG

⊟General[edit | edit source]

  • locus tag: SAUSA300_2098 [new locus tag: SAUSA300_RS11555 ]
  • symbol: ArsR
  • description: ArsR family transcriptional regulator
  • length: 106
  • theoretical pI: 8.01089
  • theoretical MW: 11988.6
  • GRAVY: -0.336792

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 25.7)
    and 3 more
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.2)
    Metabolism Amino acid biosynthesis Glutamate family arginine repressor (TIGR01529; HMM-score: 13.4)
    Signal transduction Regulatory functions DNA interactions arginine repressor (TIGR01529; HMM-score: 13.4)
  • TheSEED  :
    • Zn(II) or Co(II)-specific transcriptional repressor protein
  • PFAM:
    HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 39.6)
    and 10 more
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 23.1)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 20.7)
    TPR (CL0020) Sec8_N; Exocyst complex component Sec8 N-terminal (PF04048; HMM-score: 16.7)
    HTH (CL0123) TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16)
    HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 15.6)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.8)
    no clan defined DUF7785; Domain of unknown function (DUF7785) (PF25009; HMM-score: 14.7)
    HTH (CL0123) TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 13.8)
    MarR_2; MarR family (PF12802; HMM-score: 13.1)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 12.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by CzrA, TF important in Zinc resistance: in JSNZ, N315

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.982
    • Cytoplasmic Membrane Score: 0.0022
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0155
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003189
    • TAT(Tat/SPI): 0.000432
    • LIPO(Sec/SPII): 0.000309
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSEQYSEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKESGL

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]