Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS11235 [old locus tag: SAUSA300_2042 ]
- pan locus tag?: SAUPAN005362000
- symbol: SAUSA300_RS11235
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS11235 [old locus tag: SAUSA300_2042 ]
- symbol: SAUSA300_RS11235
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2207774..2207983
- length: 210
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2207774..2207983) NCBI
- BioCyc: SAUSA300_RS11235 BioCyc
- MicrobesOnline: see SAUSA300_2042
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATACATCAAAATACGATTTACACAGCGGGAATTGAAACAGAAGAACAAGTAAGTCAA
TTGACAGAACGCATTTCAAATATGATAGGTGTTCATCAAGTGAATATTAATATAATAGAT
GGTCAAGTAACTGTATCGTATGAGACACCAGCAAATTTGAATAGTATTGAAAAAGAAATC
TATGATGAAGGATACAAAATTGTATTTTAG60
120
180
210
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS11235 [old locus tag: SAUSA300_2042 ]
- symbol: SAUSA300_RS11235
- description: hypothetical protein
- length: 69
- theoretical pI: 4.10098
- theoretical MW: 7843.71
- GRAVY: -0.224638
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds copper ion binding protein (TIGR00003; HMM-score: 25.7)
- TheSEED: see SAUSA300_2042
- PFAM: HMA (CL0704) HMA; Heavy-metal-associated domain (PF00403; HMM-score: 27.7)and 7 moreHMA_2; Heavy metal associated domain 2 (PF19991; HMM-score: 17)E-set (CL0159) Big_3_2; Bacterial Ig-like domain (PF12245; HMM-score: 15.2)no clan defined NPHI_C; Nucleoside triphosphatase I C-terminal (PF08469; HMM-score: 14)DUF3858; Domain of Unknown Function with PDB structure (DUF3858) (PF12970; HMM-score: 13.7)PAC1; Proteasome assembly chaperone 4 (PF16094; HMM-score: 13.1)Beta_propeller (CL0186) HN; Haemagglutinin-neuraminidase (PF00423; HMM-score: 12.9)no clan defined DUF6286; Family of unknown function (DUF6286) (PF19803; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9792
- Cytoplasmic Membrane Score: 0.0126
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0081
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.0084
- TAT(Tat/SPI): 0.000413
- LIPO(Sec/SPII): 0.00082
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446503938 NCBI
- RefSeq: WP_000581792 NCBI
- UniProt: see SAUSA300_2042
⊟Protein sequence[edit | edit source]
- MIHQNTIYTAGIETEEQVSQLTERISNMIGVHQVNINIIDGQVTVSYETPANLNSIEKEIYDEGYKIVF
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]