From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1889 [new locus tag: SA_RS10870 ]
  • pan locus tag?: SAUPAN005362000
  • symbol: SA1889
  • pan gene symbol?:
  • synonym: csoZ
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1889 [new locus tag: SA_RS10870 ]
  • symbol: SA1889
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2142431..2142640
  • length: 210
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATACATCAAAATACGATTTACACAGCGGGAATTGAAACAGAAGAACAAGTAAGTCAA
    TTGACAGAACGCATTTCAAATATGATAGGTGTTCATCAAGTGAATATTAATATAATAGAT
    GGTCAAGTAACTGTATCGTATGAGACACCAGCAAATTTGAATAGTATTGAAAAAGAAATC
    TATGATGAAGGATACAAAATTGTATTTTAG
    60
    120
    180
    210

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1889 [new locus tag: SA_RS10870 ]
  • symbol: SA1889
  • description: hypothetical protein
  • length: 69
  • theoretical pI: 4.10098
  • theoretical MW: 7843.71
  • GRAVY: -0.224638

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper ion binding protein (TIGR00003; HMM-score: 25.7)
  • TheSEED  :
    • Copper(I) chaperone CopZ
  • PFAM:
    HMA (CL0704) HMA; Heavy-metal-associated domain (PF00403; HMM-score: 27.7)
    and 7 more
    HMA_2; Heavy metal associated domain 2 (PF19991; HMM-score: 17)
    E-set (CL0159) Big_3_2; Bacterial Ig-like domain (PF12245; HMM-score: 15.2)
    no clan defined NPHI_C; Nucleoside triphosphatase I C-terminal (PF08469; HMM-score: 14)
    DUF3858; Domain of Unknown Function with PDB structure (DUF3858) (PF12970; HMM-score: 13.7)
    PAC1; Proteasome assembly chaperone 4 (PF16094; HMM-score: 13.1)
    Beta_propeller (CL0186) HN; Haemagglutinin-neuraminidase (PF00423; HMM-score: 12.9)
    no clan defined DUF6286; Family of unknown function (DUF6286) (PF19803; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9792
    • Cytoplasmic Membrane Score: 0.0126
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0081
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.0084
    • TAT(Tat/SPI): 0.000413
    • LIPO(Sec/SPII): 0.00082
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIHQNTIYTAGIETEEQVSQLTERISNMIGVHQVNINIIDGQVTVSYETPANLNSIEKEIYDEGYKIVF

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]