Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1890 [new locus tag: SA_RS10875 ]
- pan locus tag?: SAUPAN005363000
- symbol: SA1890
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1890 [new locus tag: SA_RS10875 ]
- symbol: SA1890
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2142652..2142945
- length: 294
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124791 NCBI
- RefSeq: NP_375195 NCBI
- BioCyc: see SA_RS10875
- MicrobesOnline: 104221 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGACTGAACAAGATAATGCACATCATTCTGAACAAATAAAAACGAATCTTAAATCACGT
TTAAATCGAATTGAAGGACAAGTGAGAGCGATTAATCGCATGATTGAAGAAGATGTCTAT
TGTGATGATGTCCTTACGCAAATAAGAGCGACACGTTCGGCGTTAAACAGTGTTGCGATA
AAGTTATTAGAACAACATATGAAAAGTTGTATTATGAATAAAGTTAATCAAGGTGCTCAG
GAAGAGGCAATGGAAGAGTTATTAGTGACTTTTCAAAAATTGATTAAAGACTAA60
120
180
240
294
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1890 [new locus tag: SA_RS10875 ]
- symbol: SA1890
- description: hypothetical protein
- length: 97
- theoretical pI: 6.24941
- theoretical MW: 11197.8
- GRAVY: -0.548454
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General zinc finger protein ZPR1 homolog (TIGR00340; HMM-score: 14.1)Mobile and extrachromosomal element functions Prophage functions phage terminase, large subunit, PBSX family (TIGR01547; HMM-score: 12.8)
- TheSEED :
- Repressor CsoR of the copZA operon
- PFAM: no clan defined Trns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 98.2)and 5 moreTPR (CL0020) DHR-2_Lobe_C; DHR-2, Lobe C (PF20421; HMM-score: 16.7)SPO22; Meiosis protein SPO22/ZIP4 like (PF08631; HMM-score: 14.4)no clan defined CdaS_N; Diadenylate cyclase CdaS, N-terminal (PF10372; HMM-score: 14.1)Herpes_UL14; Herpesvirus UL14-like protein (PF03580; HMM-score: 12.8)AvrE_T3Es; AvrE-family Type-III effector proteins (T3Es) (PF11725; HMM-score: 10.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.986
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.0127
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003419
- TAT(Tat/SPI): 0.000516
- LIPO(Sec/SPII): 0.000463
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVLTQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQEEAMEELLVTFQKLIKD
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]