From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS10940 [old locus tag: SAUSA300_1990 ]
  • pan locus tag?: SAUPAN005276000
  • symbol: SAUSA300_RS10940
  • pan gene symbol?: agrD
  • synonym:
  • product: cyclic lactone autoinducer peptide

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS10940 [old locus tag: SAUSA300_1990 ]
  • symbol: SAUSA300_RS10940
  • product: cyclic lactone autoinducer peptide
  • replicon: chromosome
  • strand: +
  • coordinates: 2147508..2147648
  • length: 141
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAATACATTATTTAACTTATTTTTTGATTTTATTACTGGGATTTTAAAAAACATTGGT
    AACATCGCAGCTTATAGTACTTGTGACTTCATAATGGATGAAGTTGAAGTACCAAAAGAA
    TTAACACAATTACACGAATAA
    60
    120
    141

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS10940 [old locus tag: SAUSA300_1990 ]
  • symbol: SAUSA300_RS10940
  • description: cyclic lactone autoinducer peptide
  • length: 46
  • theoretical pI: 3.96381
  • theoretical MW: 5297.07
  • GRAVY: 0.293478

Function[edit | edit source]

  • TIGRFAM:
    cyclic lactone autoinducer peptide (TIGR04223; HMM-score: 33.2)
  • TheSEED: see SAUSA300_1990
  • PFAM:
    no clan defined AgrD; Staphylococcal AgrD protein (PF05931; HMM-score: 95.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.09954
    • TAT(Tat/SPI): 0.007564
    • LIPO(Sec/SPII): 0.117094
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNTLFNLFFDFITGILKNIGNIAAYSTCDFIMDEVEVPKELTQLHE

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]