Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001990 [new locus tag: EGJ38_RS09935 ]
- pan locus tag?: SAUPAN005276000
- symbol: agrD
- pan gene symbol?: agrD
- synonym:
- alternate name: JSNZ_001990
- product: cyclic lactone autoinducer peptide AgrD
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001990 [new locus tag: EGJ38_RS09935 ]
- symbol: agrD
- product: cyclic lactone autoinducer peptide AgrD
- replicon: chromosome
- strand: +
- coordinates: 2004210..2004350
- length: 141
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423897 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAAAAATTACTCAACAAAGTTATTGAGCTTTTAGTTGACTTTTTCAACAGCATCGGT
TACAGAGCCGCGTATATAAATTGTGATTTTTTATTGGACGAAGCTGAAGTACCAAAAGAA
TTAACTCAATTACACGAATAA60
120
141
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001990 [new locus tag: EGJ38_RS09935 ]
- symbol: AgrD
- description: cyclic lactone autoinducer peptide AgrD
- length: 46
- theoretical pI: 4.53515
- theoretical MW: 5385.24
- GRAVY: 0.0717391
⊟Function[edit | edit source]
- TIGRFAM: cyclic lactone autoinducer peptide (TIGR04223; HMM-score: 29.5)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined AgrD; Staphylococcal AgrD protein (PF05931; HMM-score: 48.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.3464
- Cytoplasmic Membrane Score: 0.2639
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.3894
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.063074
- TAT(Tat/SPI): 0.001213
- LIPO(Sec/SPII): 0.015083
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423897 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKLLNKVIELLVDFFNSIGYRAAYINCDFLLDEAEVPKELTQLHE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ 2.0 2.1 Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)