Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07415 [old locus tag: SAUSA300_1360 ]
- pan locus tag?: SAUPAN003931000
- symbol: SAUSA300_RS07415
- pan gene symbol?: ubiE
- synonym:
- product: demethylmenaquinone methyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07415 [old locus tag: SAUSA300_1360 ]
- symbol: SAUSA300_RS07415
- product: demethylmenaquinone methyltransferase
- replicon: chromosome
- strand: -
- coordinates: 1527251..1527976
- length: 726
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1527251..1527976) NCBI
- BioCyc: SAUSA300_RS07415 BioCyc
- MicrobesOnline: see SAUSA300_1360
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGGCTGACAATAAAGCAAATAAAGAGCAAGTACATCGCGTTTTTCAAAATATTTCAAAA
AAATATGATAGATTAAATAATATTATTAGTTTTGAGCAGCATAAAGTATGGAGAAAACGC
GTCATGAAAGACATGGGTGTTAGAAAAGGGACGAAAGCATTAGATGTTTGTTGTGGTACT
GGTGATTGGACAATCGCATTAAGCAAAGCTGTAGGACCAACAGGTGAAGTTACTGGTATT
GACTTTAGTGAGAATATGTTAGAAGTAGGAAAAGAAAAAACTGCTTCAATGGAAAATGTT
AAACTTGTTCATGGTGATGCAATGGAATTGCCGTTTGAAGACAATTCTTTTGATTATGTA
ACAATTGGGTTTGGATTAAGAAATGTGCCAGACTATTTAGTCGCGTTAAAAGAAATGAAT
AGAGTACTTAAACCAGGTGGTATGGTGGTATGTCTTGAAACGAGCCAACCAACTTTGCCA
GTCTTTAAACAAATGTATGCACTATACTTTAAATTTGTTATGCCTATTTTTGGAAAATTA
TTTGCAAAATCAAAAGAAGAATATGAATGGTTACAGCAATCTACGTTTAATTTTCCTGGA
AAAGAAGAGTTGAAGCGCATGTTTGAAGAAGCAGGTTTCATAAATGTAAGAGTACGTAGT
TTTACAGGGGGCGTTGCTGCAATGCACCTTGGCTATAAAGAAAAAGATAATACCAAAGGT
GATTAA60
120
180
240
300
360
420
480
540
600
660
720
726
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07415 [old locus tag: SAUSA300_1360 ]
- symbol: SAUSA300_RS07415
- description: demethylmenaquinone methyltransferase
- length: 241
- theoretical pI: 9.02909
- theoretical MW: 27422.5
- GRAVY: -0.378838
⊟Function[edit | edit source]
- reaction: EC 2.1.1.-? ExPASy
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 402.2)and 23 moreBiosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 300.9)Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 64.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 41.7)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 36.6)Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 36.5)Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 31.4)Unknown function Enzymes of unknown specificity tRNA (cmo5U34)-methyltransferase (TIGR00740; EC 2.1.1.-; HMM-score: 31.3)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 30)methyltransferase, FxLD system (TIGR04364; HMM-score: 28.8)Protein fate Protein modification and repair protein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 27.2)Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 23.8)Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 23.2)Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 21.6)Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 20.5)Protein synthesis tRNA and rRNA base modification ribosomal RNA large subunit methyltransferase J (TIGR00438; EC 2.1.1.166; HMM-score: 16.6)Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 15.9)Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 15.5)Unknown function Enzymes of unknown specificity tRNA (mo5U34)-methyltransferase (TIGR00452; EC 2.1.1.-; HMM-score: 15.3)methyltransferase, ATP-grasp peptide maturase system (TIGR04188; HMM-score: 13.6)methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 12.7)Hypothetical proteins Conserved putative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 12.3)2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 11.8)Protein synthesis Ribosomal proteins: synthesis and modification putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 11.3)
- TheSEED: see SAUSA300_1360
- PFAM: NADP_Rossmann (CL0063) Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 323.4)and 23 moreMethyltransf_25; Methyltransferase domain (PF13649; HMM-score: 93.5)Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 85.6)Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 80.4)Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 65.1)Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 56.5)PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 39.8)FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 30.6)Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 28.8)MTS; Methyltransferase small domain (PF05175; HMM-score: 21.7)CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 21.5)MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 21)Methyltransf_8; Hypothetical methyltransferase (PF05148; HMM-score: 20.8)GCD14; tRNA methyltransferase complex GCD14 subunit (PF08704; HMM-score: 20.3)Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 19.2)RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 17.5)Rsm22; Mitochondrial small ribosomal subunit Rsm22 (PF09243; HMM-score: 17.4)NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 14.7)Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 14.5)Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 14.5)Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 13.8)Methyltransf_3; O-methyltransferase (PF01596; HMM-score: 13.1)ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 12.7)Methyltransf_29; Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.061569
- TAT(Tat/SPI): 0.000665
- LIPO(Sec/SPII): 0.000878
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446697338 NCBI
- RefSeq: WP_000774684 NCBI
- UniProt: see SAUSA300_1360
⊟Protein sequence[edit | edit source]
- MADNKANKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVGPTGEVTGIDFSENMLEVGKEKTASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMNRVLKPGGMVVCLETSQPTLPVFKQMYALYFKFVMPIFGKLFAKSKEEYEWLQQSTFNFPGKEELKRMFEEAGFINVRVRSFTGGVAAMHLGYKEKDNTKGD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_RS07335 (asnC) asparagine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS00050 serine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS00585 peptidoglycan-binding protein LysM [1] (data from MRSA252) SAUSA300_RS00735 2-deoxyribose-5-phosphate aldolase [1] (data from MRSA252) SAUSA300_RS01155 formate acetyltransferase [1] (data from MRSA252) SAUSA300_RS01250 L-lactate dehydrogenase [1] (data from MRSA252) SAUSA300_RS01330 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) SAUSA300_RS01635 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) SAUSA300_RS02025 alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) SAUSA300_RS02055 hypothetical protein [1] (data from MRSA252) SAUSA300_RS02070 IMP dehydrogenase [1] (data from MRSA252) SAUSA300_RS02575 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) SAUSA300_RS02635 cysteine synthase [1] (data from MRSA252) SAUSA300_RS02795 50S ribosomal protein L11 [1] (data from MRSA252) SAUSA300_RS02800 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_RS02805 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_RS02810 50S ribosomal protein L7/L12 [1] (data from MRSA252) SAUSA300_RS02820 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SAUSA300_RS02825 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SAUSA300_RS02845 elongation factor G [1] (data from MRSA252) SAUSA300_RS02850 elongation factor Tu [1] (data from MRSA252) SAUSA300_RS03050 phosphate acetyltransferase [1] (data from MRSA252) SAUSA300_RS03190 zinc-dependent alcohol dehydrogenase [1] (data from MRSA252) SAUSA300_RS03960 ribosomal subunit interface protein [1] (data from MRSA252) SAUSA300_RS04080 aldehyde dehydrogenase [1] (data from MRSA252) SAUSA300_RS04085 phosphoglycerate kinase [1] (data from MRSA252) SAUSA300_RS04090 triose-phosphate isomerase [1] (data from MRSA252) SAUSA300_RS04100 enolase [1] (data from MRSA252) SAUSA300_RS04645 NAD-specific glutamate dehydrogenase [1] (data from MRSA252) SAUSA300_RS04925 hypothetical protein [1] (data from MRSA252) SAUSA300_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SAUSA300_RS05355 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SAUSA300_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SAUSA300_RS05365 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SAUSA300_RS05620 thiol reductase thioredoxin [1] (data from MRSA252) SAUSA300_RS05855 cell division protein FtsZ [1] (data from MRSA252) SAUSA300_RS06080 beta-ketoacyl-ACP reductase [1] (data from MRSA252) SAUSA300_RS06135 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_RS06160 succinyl-CoA ligase subunit beta [1] (data from MRSA252) SAUSA300_RS06230 elongation factor Ts [1] (data from MRSA252) SAUSA300_RS06240 ribosome-recycling factor [1] (data from MRSA252) SAUSA300_RS06290 translation initiation factor IF-2 [1] (data from MRSA252) SAUSA300_RS06315 polyribonucleotide nucleotidyltransferase [1] (data from MRSA252) SAUSA300_RS06485 glutamine synthetase [1] (data from MRSA252) SAUSA300_RS07165 glucose-specific phosphotransferase enzyme IIA component [1] (data from MRSA252) SAUSA300_RS08135 elongation factor P [1] (data from MRSA252) SAUSA300_RS08395 molecular chaperone DnaK [1] (data from MRSA252) SAUSA300_RS08720 50S ribosomal protein L27 [1] (data from MRSA252) SAUSA300_RS08730 50S ribosomal protein L21 [1] (data from MRSA252) SAUSA300_RS08835 ATP-dependent Clp protease ATP-binding subunit ClpX [1] (data from MRSA252) SAUSA300_RS08840 trigger factor [1] (data from MRSA252) SAUSA300_RS08885 threonine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS08910 aldehyde dehydrogenase [1] (data from MRSA252) SAUSA300_RS08950 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) SAUSA300_RS08975 pyruvate kinase [1] (data from MRSA252) SAUSA300_RS08980 ATP-dependent 6-phosphofructokinase [1] (data from MRSA252) SAUSA300_RS09045 acetate kinase [1] (data from MRSA252) SAUSA300_RS09090 30S ribosomal protein S4 [1] (data from MRSA252) SAUSA300_RS09165 formate--tetrahydrofolate ligase [1] (data from MRSA252) SAUSA300_RS09265 D-alanine aminotransferase [1] (data from MRSA252) SAUSA300_RS09270 dipeptidase PepV [1] (data from MRSA252) SAUSA300_RS10300 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C [1] (data from MRSA252) SAUSA300_RS10900 molecular chaperone GroEL [1] (data from MRSA252) SAUSA300_RS10905 co-chaperone GroES [1] (data from MRSA252) SAUSA300_RS11380 uracil phosphoribosyltransferase [1] (data from MRSA252) SAUSA300_RS11440 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SAUSA300_RS11445 fructose-bisphosphate aldolase [1] (data from MRSA252) SAUSA300_RS11460 DNA-directed RNA polymerase subunit delta [1] (data from MRSA252) SAUSA300_RS11600 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SAUSA300_RS11805 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SAUSA300_RS11985 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_RS12020 DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) SAUSA300_RS12055 50S ribosomal protein L15 [1] (data from MRSA252) SAUSA300_RS12070 50S ribosomal protein L18 [1] (data from MRSA252) SAUSA300_RS12080 30S ribosomal protein S8 [1] (data from MRSA252) SAUSA300_RS12090 50S ribosomal protein L5 [1] (data from MRSA252) SAUSA300_RS12095 50S ribosomal protein L24 [1] (data from MRSA252) SAUSA300_RS12120 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_RS12125 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_RS12145 50S ribosomal protein L4 [1] (data from MRSA252) SAUSA300_RS12150 50S ribosomal protein L3 [1] (data from MRSA252) SAUSA300_RS12155 30S ribosomal protein S10 [1] (data from MRSA252) SAUSA300_RS13840 L-glutamate gamma-semialdehyde dehydrogenase [1] (data from MRSA252) SAUSA300_RS14100 class I fructose-bisphosphate aldolase [1] (data from MRSA252) SAUSA300_RS14105 malate:quinone oxidoreductase [1] (data from MRSA252) SAUSA300_RS14290 ornithine carbamoyltransferase [1] (data from MRSA252) SAUSA300_RS14295 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 1.70 1.71 1.72 1.73 1.74 1.75 1.76 1.77 1.78 1.79 1.80 1.81 1.82 1.83 1.84 1.85 1.86 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)