Jump to navigation
		Jump to search
		
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07360 [old locus tag: SAUSA300_1350 ]
- pan locus tag?: SAUPAN003919000
- symbol: SAUSA300_RS07360
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07360 [old locus tag: SAUSA300_1350 ]
- symbol: SAUSA300_RS07360
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1517567..1517884
- length: 318
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1517567..1517884) NCBI
- BioCyc: SAUSA300_RS07360 BioCyc
- MicrobesOnline: see SAUSA300_1350
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301ATGAAATCAATGGTAGAAATGCAACGTGAAGTTGATGAATATATTGGACAATTTAAAACA
 GGATATTTTTCACCATTAGCTAACTTAGCTAGATTGACTGAAGAAGTGGGCGAACTTGCA
 CGTGAAATAAATCATACCTATGGTGAAAAAAAGAAGAAAGATTCAGAGGAAGCAAATACG
 ATTAAAGCAGAATTAGGTGATAATTTATTTGTGTTGTTATGTTTAGCGAATTCAATGGGA
 ATAGATATGACAGAGAGCTTTAATGAAACAATGGAAAAGTTTAATACAAGAGATAAAAAT
 CGATTCGAAAGAAAGTGA60
 120
 180
 240
 300
 318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07360 [old locus tag: SAUSA300_1350 ]
- symbol: SAUSA300_RS07360
- description: hypothetical protein
- length: 105
- theoretical pI: 4.81549
- theoretical MW: 12194.7
- GRAVY: -0.766667
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General MazG family protein (TIGR00444; HMM-score: 25.4)
- TheSEED: see SAUSA300_1350
- PFAM: MazG (CL0231) MazG; MazG nucleotide pyrophosphohydrolase domain (PF03819; HMM-score: 70.5)and 4 moredUTPase_2; dUTPase (PF08761; HMM-score: 26.5)PRA-PH; Phosphoribosyl-ATP pyrophosphohydrolase (PF01503; HMM-score: 17.6)MazG-like; MazG-like family (PF12643; HMM-score: 15.8)no clan defined Phage_CP76; Phage regulatory protein CII (CP76) (PF06892; HMM-score: 15.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.9868
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0128
 
- LocateP:
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.008515
- TAT(Tat/SPI): 0.000596
- LIPO(Sec/SPII): 0.001447
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446762670 NCBI
- RefSeq: WP_000839926 NCBI
- UniProt: see SAUSA300_1350
⊟Protein sequence[edit | edit source]
- MKSMVEMQREVDEYIGQFKTGYFSPLANLARLTEEVGELAREINHTYGEKKKKDSEEANTIKAELGDNLFVLLCLANSMGIDMTESFNETMEKFNTRDKNRFERK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]