Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS05160 [old locus tag: SAUSA300_0960 ]
- pan locus tag?: SAUPAN003267000
- symbol: SAUSA300_RS05160
- pan gene symbol?: qoxD
- synonym:
- product: quinol oxidase subunit 4
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS05160 [old locus tag: SAUSA300_0960 ]
- symbol: SAUSA300_RS05160
- product: quinol oxidase subunit 4
- replicon: chromosome
- strand: -
- coordinates: 1052722..1053012
- length: 291
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1052722..1053012) NCBI
- BioCyc: SAUSA300_RS05160 BioCyc
- MicrobesOnline: see SAUSA300_0960
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGTACAATAATGAAACATACTGTAGGATTTATCGCATCTATCGTATTAACGCTTTTA
GCAGTTTACGTAACACTATACACGTCATTAACATTCCACGCGAAGTTGACAATTATCTTT
GGCTTTGCATTCGTCCAAGCAGGACTTCAATTATTAATGTTCATGCATTTAACTGAAGGT
AAAGATGGACGTTTACAAACATTCAAAGTTATCTTTGCTCTTGTAATTACACTTTGTTTC
GTTGTCGGAACATATTGGGTTATGCAAGGCGGTCACTCTTCACACTTATAA60
120
180
240
291
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS05160 [old locus tag: SAUSA300_0960 ]
- symbol: SAUSA300_RS05160
- description: quinol oxidase subunit 4
- length: 96
- theoretical pI: 9.69391
- theoretical MW: 10686.8
- GRAVY: 1.01979
⊟Function[edit | edit source]
- reaction: EC 1.9.3.-? ExPASyEC 1.10.3.-? ExPASy2 a quinol + O2 = 2 a quinone + 2 H2O?
- TIGRFAM: Energy metabolism Electron transport cytochrome aa3 quinol oxidase, subunit IV (TIGR02901; EC 1.10.3.-; HMM-score: 104.3)and 3 moreEnergy metabolism Electron transport cytochrome o ubiquinol oxidase subunit IV (TIGR02847; EC 1.10.3.-; HMM-score: 55.5)Energy metabolism Electron transport caa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 16.8)Energy metabolism Electron transport cytochrome c oxidase, subunit IVB (TIGR02908; EC 1.9.3.1; HMM-score: 15.5)
- TheSEED: see SAUSA300_0960
- PFAM: no clan defined COX4_pro; Prokaryotic Cytochrome C oxidase subunit IV (PF03626; HMM-score: 46.8)and 4 moreRhomboid-like (CL0207) Rhomboid; Rhomboid family (PF01694; HMM-score: 14.2)MtN3-like (CL0141) MtN3_slv; Sugar efflux transporter for intercellular exchange (PF03083; HMM-score: 14)no clan defined DUF5654; Family of unknown function (DUF5654) (PF18898; HMM-score: 10.1)DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 7.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9998
- Cell wall & surface Score: 0
- Extracellular Score: 0.0002
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005989
- TAT(Tat/SPI): 0.00029
- LIPO(Sec/SPII): 0.002534
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI: 446026399 NCBI
- RefSeq: WP_000104254 NCBI
- UniProt: see SAUSA300_0960
⊟Protein sequence[edit | edit source]
- MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEGKDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.