Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00999
- pan locus tag?: SAUPAN003267000
- symbol: SAOUHSC_00999
- pan gene symbol?: qoxD
- synonym:
- product: quinol oxidase subunit IV
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_00999
- symbol: SAOUHSC_00999
- product: quinol oxidase subunit IV
- replicon: chromosome
- strand: -
- coordinates: 972596..972874
- length: 279
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3920399 NCBI
- RefSeq: YP_499551 NCBI
- BioCyc: G1I0R-941 BioCyc
- MicrobesOnline: 1289464 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAACATACTGTAGGATTTATCGCATCTATCGTATTAACGCTTTTAGCAGTTTACGTA
ACACTATACACGTCATTAACATTCCACGCGAAGTTGACAATTATCTTTGGCTTTGCATTC
GTCCAAGCAGGACTTCAATTATTAATGTTCATGCATTTAACTGAAGGTAAAGATGGACGT
TTACAAACATTCAAAGTTATCTTTGCTCTTGTAATTACACTTTGTTTCGTTGTCGGAACA
TATTGGGTTATGCAAGGCGGTCACTCTTCACACTTATAA60
120
180
240
279
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00999
- symbol: SAOUHSC_00999
- description: quinol oxidase subunit IV
- length: 92
- theoretical pI: 9.69391
- theoretical MW: 10254.3
- GRAVY: 1.01087
⊟Function[edit | edit source]
- reaction: EC 1.9.3.-? ExPASyEC 1.10.3.-? ExPASy2 a quinol + O2 = 2 a quinone + 2 H2O?
- TIGRFAM: Energy metabolism Electron transport cytochrome aa3 quinol oxidase, subunit IV (TIGR02901; EC 1.10.3.-; HMM-score: 104)and 3 moreEnergy metabolism Electron transport cytochrome o ubiquinol oxidase subunit IV (TIGR02847; EC 1.10.3.-; HMM-score: 55.7)Energy metabolism Electron transport caa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 17.7)Energy metabolism Electron transport cytochrome c oxidase, subunit IVB (TIGR02908; EC 1.9.3.1; HMM-score: 14.6)
- TheSEED :
- AA3-600 quinol oxidase subunit IV
- PFAM: no clan defined COX4_pro; Prokaryotic Cytochrome C oxidase subunit IV (PF03626; HMM-score: 47)and 4 moreMtN3-like (CL0141) MtN3_slv; Sugar efflux transporter for intercellular exchange (PF03083; HMM-score: 14.5)Rhomboid-like (CL0207) Rhomboid; Rhomboid family (PF01694; HMM-score: 14)no clan defined DUF5654; Family of unknown function (DUF5654) (PF18898; HMM-score: 10.1)DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 7.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9998
- Cell wall & surface Score: 0
- Extracellular Score: 0.0002
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014241
- TAT(Tat/SPI): 0.000346
- LIPO(Sec/SPII): 0.004461
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEGKDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [1] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)