From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00999
  • pan locus tag?: SAUPAN003267000
  • symbol: SAOUHSC_00999
  • pan gene symbol?: qoxD
  • synonym:
  • product: quinol oxidase subunit IV

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00999
  • symbol: SAOUHSC_00999
  • product: quinol oxidase subunit IV
  • replicon: chromosome
  • strand: -
  • coordinates: 972596..972874
  • length: 279
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAACATACTGTAGGATTTATCGCATCTATCGTATTAACGCTTTTAGCAGTTTACGTA
    ACACTATACACGTCATTAACATTCCACGCGAAGTTGACAATTATCTTTGGCTTTGCATTC
    GTCCAAGCAGGACTTCAATTATTAATGTTCATGCATTTAACTGAAGGTAAAGATGGACGT
    TTACAAACATTCAAAGTTATCTTTGCTCTTGTAATTACACTTTGTTTCGTTGTCGGAACA
    TATTGGGTTATGCAAGGCGGTCACTCTTCACACTTATAA
    60
    120
    180
    240
    279


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00999
  • symbol: SAOUHSC_00999
  • description: quinol oxidase subunit IV
  • length: 92
  • theoretical pI: 9.69391
  • theoretical MW: 10254.3
  • GRAVY: 1.01087

⊟Function[edit | edit source]

  • reaction:
    EC 1.9.3.-?  ExPASy
    EC 1.10.3.-?  ExPASy
    2 a quinol + O2 = 2 a quinone + 2 H2O?
  • TIGRFAM:
    Metabolism Energy metabolism Electron transport cytochrome aa3 quinol oxidase, subunit IV (TIGR02901; EC 1.10.3.-; HMM-score: 104)
    and 3 more
    Metabolism Energy metabolism Electron transport cytochrome o ubiquinol oxidase subunit IV (TIGR02847; EC 1.10.3.-; HMM-score: 55.7)
    Metabolism Energy metabolism Electron transport caa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 17.7)
    Metabolism Energy metabolism Electron transport cytochrome c oxidase, subunit IVB (TIGR02908; EC 1.9.3.1; HMM-score: 14.6)
  • TheSEED  :
    • AA3-600 quinol oxidase subunit IV
    Respiration Electron accepting reactions Terminal cytochrome C oxidases  quinol oxidase polypeptide IV QoxD (EC:1.9.3.-)
  • PFAM:
    no clan defined COX4_pro; Prokaryotic Cytochrome C oxidase subunit IV (PF03626; HMM-score: 47)
    and 4 more
    MtN3-like (CL0141) MtN3_slv; Sugar efflux transporter for intercellular exchange (PF03083; HMM-score: 14.5)
    Rhomboid-like (CL0207) Rhomboid; Rhomboid family (PF01694; HMM-score: 14)
    no clan defined DUF5654; Family of unknown function (DUF5654) (PF18898; HMM-score: 10.1)
    DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 7.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9998
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0002
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014241
    • TAT(Tat/SPI): 0.000346
    • LIPO(Sec/SPII): 0.004461
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEGKDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.0 1.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_00999&oldid=135349"