PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus USA300_FPR3757
• locus tag: SAUSA300_RS04815 [old locus tag: SAUSA300_0893 ]
• pan locus tag^?: SAUPAN003149000
• symbol: SAUSA300_RS04815
• pan gene symbol^?: opp4D
• synonym:
• product: ABC transporter ATP-binding protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAUSA300_RS04815 [old locus tag: SAUSA300_0893 ]
• symbol: SAUSA300_RS04815
• product: ABC transporter ATP-binding protein
• replicon: chromosome
• strand: +
• coordinates: 981827..982813
• length: 987
• essential: unknown other strains

⊟Accession numbers

• Location: NC_007793 (981827..982813) NCBI
• BioCyc: SAUSA300_RS04815 BioCyc
• MicrobesOnline: see SAUSA300_0893

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  421
  481
  541
  601
  661
  721
  781
  841
  901
  961
  
  ATGAATAATGTATTGTTAGAGGTTAAAGATTTAGAAACATCATTAAAAATAAATAATGAA
  TGGTTAGCAACTGTTGAAAATATTTCTTTTGAATTATCTAAAGGAGAAGTTTTGGGTATA
  GTAGGGGAATCTGGTTGCGGTAAGTCCATATTAAGTAAGTCAATTATTAAATTATTACCA
  GAAAAGATATCTAAACTAAGTAATGGAGAAGTTATATTTGATGGTAAACGAATCGATACG
  CTCAATGAGAAGCAATTGCCAGATATTCGAGGAAATGATATTGCTATGATTTTTCAAGAA
  CCTATGACTGCTTTAAATCCTGTATTTACCATAAAAAATCAACTTGTGGAATCTATAAAA
  TCACATAAAAAAATTTCTAAAAAAGAAGCAAATAAATTAGCAAAAGATTTACTAAAAAAA
  GTTGGAATTGCTAGACAAGATGAAATATTAAATAGCTATCCTCATCAATTATCTGGTGGT
  ATGAGACAAAGAGTAATGATTGCAATGGCCATTTCATGTTCTCCTAAATTATTAATTGCT
  GATGAACCTACAACAGCATTGGATGTCACGATTCAAGCGCAAATATTAGACTTATTAAAA
  GAATTGCAAAAGGAAACGCAAATGGCAATTATGATGATTACACATGATTTGAGTGTAGTT
  GCTGAGTTTTGCGATAAAGTCTTAGTTATGTATGCAGGTCAAATTGTAGAATTTGGAGGC
  ATAAAAGAAATACTACACAATCCGAAACATCCTTATACCCAAAAATTATTATCAACAATT
  CCAAAACTTAAAGAAGAGCAGAAACGACTTGAAACGATAGAAGGAATTGTGCCATCAATC
  CAAGCATTTCACGTTAATAAGTGCAGATTTGCAAATAGATGTAACAAAAAACTGGATATT
  TGTAATAATCAATCTCCTAAAATGCATGTTTGTGAAGATGTCATTGTACGTTGTCATTTG
  TACAAAAATGAATATAAGGAGATATAA
  60
  120
  180
  240
  300
  360
  420
  480
  540
  600
  660
  720
  780
  840
  900
  960
  987
  

⊟Protein

⊟General

• locus tag: SAUSA300_RS04815 [old locus tag: SAUSA300_0893 ]
• symbol: SAUSA300_RS04815
• description: ABC transporter ATP-binding protein
• length: 328
• theoretical pI: 8.38832
• theoretical MW: 36987.2
• GRAVY: -0.172561

⊟Function

• TIGRFAM:
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 282.7)
  and 73 more
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 192.9)
  Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 171.6)
  Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 153.6)
  D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 153.2)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 152.7)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 143.9)
  Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 143.7)
  Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 142.2)
  ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 141.2)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 140.2)
  ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 129.3)
  Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 128.7)
  Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 128.7)
  Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 125.4)
  Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 124.6)
  Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 123.9)
  Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 119.7)
  Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 117.6)
  2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 114.1)
  Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 113.2)
  Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 113.2)
  Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 110.4)
  Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 108.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 108.2)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 100.8)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 100.8)
  proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 100)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 98.2)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 97)
  Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 97)
  Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 94)
  Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 93)
  Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 92.9)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 92.1)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 92.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 91)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 90.6)
  Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 90.2)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 90.2)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 90.1)
  Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 90.1)
  thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 88.7)
  Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 87.2)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 86.6)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 86.2)
  Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 86.1)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 85.9)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 84.6)
  phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 82.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81.7)
  Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81.7)
  Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81.7)
  ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 80.4)
  Metabolism Transport and binding proteins Amino acids, peptides and amines oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain (TIGR01727; HMM-score: 78.9)
  gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 76.3)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 74.7)
  Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 72.4)
  Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 72.4)
  lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 70.8)
  thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 69.5)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 58.4)
  Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 58.4)
  ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 55.2)
  Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 46.4)
  Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 46.3)
  Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 39.7)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 38.9)
  Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 37.2)
  Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 36)
  Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 36)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 31.4)
  Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13.1)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA repair protein RecN (TIGR00634; HMM-score: 13.1)
• TheSEED: see SAUSA300_0893
• PFAM:
  P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 108.1)
  and 17 more
  no clan defined oligo_HPY; Oligopeptide/dipeptide transporter, C-terminal region (PF08352; HMM-score: 64.1)
  P-loop_NTPase (CL0023) SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 41.4)
  AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 27.4)
  RNA_helicase; RNA helicase (PF00910; HMM-score: 19.8)
  AAA_23; AAA domain (PF13476; HMM-score: 19.6)
  AAA_22; AAA domain (PF13401; HMM-score: 19.5)
  Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 15)
  RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 14.8)
  ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 14.6)
  AAA_16; AAA ATPase domain (PF13191; HMM-score: 14.5)
  DUF87; Domain of unknown function DUF87 (PF01935; HMM-score: 14.4)
  NB-ARC; NB-ARC domain (PF00931; HMM-score: 13.8)
  ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.6)
  NACHT; NACHT domain (PF05729; HMM-score: 13.2)
  no clan defined DUF2373; Uncharacterised conserved protein (DUF2373) (PF10180; HMM-score: 12.8)
  P-loop_NTPase (CL0023) AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 11.8)
  AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 11.5)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 1.05
  • Cytoplasmic Membrane Score: 8.78
  • Cellwall Score: 0.08
  • Extracellular Score: 0.09
  • Internal Helices: 0
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.008538
  • TAT(Tat/SPI): 0.000313
  • LIPO(Sec/SPII): 0.001036
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 446989793 NCBI
• RefSeq: WP_001067049 NCBI
• UniProt: see SAUSA300_0893

⊟Protein sequence

• MNNVLLEVKDLETSLKINNEWLATVENISFELSKGEVLGIVGESGCGKSILSKSIIKLLPEKISKLSNGEVIFDGKRIDTLNEKQLPDIRGNDIAMIFQEPMTALNPVFTIKNQLVESIKSHKKISKKEANKLAKDLLKKVGIARQDEILNSYPHQLSGGMRQRVMIAMAISCSPKLLIADEPTTALDVTIQAQILDLLKELQKETQMAIMMITHDLSVVAEFCDKVLVMYAGQIVEFGGIKEILHNPKHPYTQKLLSTIPKLKEEQKRLETIEGIVPSIQAFHVNKCRFANRCNKKLDICNNQSPKMHVCEDVIVRCHLYKNEYKEI

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator: CodY see SAUSA300_0893

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications