PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus USA300_FPR3757
• locus tag: SAUSA300_RS03560 [old locus tag: SAUSA300_0663 ]
• pan locus tag^?: SAUPAN002561000
• symbol: SAUSA300_RS03560
• pan gene symbol^?: —
• synonym:
• product: hypothetical protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAUSA300_RS03560 [old locus tag: SAUSA300_0663 ]
• symbol: SAUSA300_RS03560
• product: hypothetical protein
• replicon: chromosome
• strand: +
• coordinates: 738373..738768
• length: 396
• essential: unknown other strains

⊟Accession numbers

• Location: NC_007793 (738373..738768) NCBI
• BioCyc: SAUSA300_RS03560 BioCyc
• MicrobesOnline: see SAUSA300_0663

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  
  ATGAAGAAATTAATCATCAGTATTATGGCGGTCATGCTATTTTTAACAGGTTGTGGTAAA
  AGTCAAGAGAAAGCCACTCTGGAAAAGGATATCGATAATTTACAAAAAGAAAATAAAGAA
  TTAAAAGACAAAAAAGAAAAGCTTCAACAAGAAAAAGAAAAATTAGCAGATAAGCAAAAA
  GACCTTGAAAAAGAAGTGAAAGATTTAAAACCTTCAAAAGAAGATAACAAGGATGATAAA
  AAAGACGAAGACAAAAATAAAGACAAAGATAAAGATAAAGAGGCATCACAAGATAAGCAA
  TCAAAAGATCAAACTAAGTCATCGGATAAAGATAATCACAAAAAGCCTACATCAGCAGAT
  AAAGATCAAAAAGCTAATGACAAACACCAATCATAA
  60
  120
  180
  240
  300
  360
  396
  

⊟Protein

⊟General

• locus tag: SAUSA300_RS03560 [old locus tag: SAUSA300_0663 ]
• symbol: SAUSA300_RS03560
• description: hypothetical protein
• length: 131
• theoretical pI: 9.36324
• theoretical MW: 15188
• GRAVY: -1.87863

⊟Function

• TIGRFAM:
  Cellular processes Cellular processes Sporulation and germination transcription factor, RsfA family (TIGR02894; HMM-score: 19.6)
  Signal transduction Regulatory functions DNA interactions transcription factor, RsfA family (TIGR02894; HMM-score: 19.6)
  Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 19.4)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 16.7)
  and 14 more
  SH3 domain protein (TIGR04211; HMM-score: 9.6)
  Cellular processes Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 7.9)
  Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)
  Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)
  Genetic information processing Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 5.7)
  type IV conjugative transfer system protein TraV (TIGR02747; HMM-score: 5.5)
  Genetic information processing Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 5.5)
  Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)
  Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)
  Cellular processes Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 5.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 5.1)
  Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 4.2)
  Cellular processes Cellular processes Cell division cell division protein FtsN (TIGR02223; HMM-score: 4.1)
  Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AE (TIGR02829; HMM-score: 3.2)
• TheSEED: see SAUSA300_0663
• PFAM:
  no clan defined TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 18.9)
  and 16 more
  Striatin; Striatin family (PF08232; HMM-score: 12.7)
  Leu_zip; Leucine zipper (PF15294; HMM-score: 12.5)
  Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 10.9)
  DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 10.3)
  FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 10.2)
  BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 10.2)
  FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 10)
  GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 9.5)
  AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 9.4)
  no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 9.1)
  NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 8.5)
  YabA; Initiation control protein YabA (PF06156; HMM-score: 7.5)
  APG6_N; Apg6 coiled-coil region (PF17675; HMM-score: 7.3)
  Snu56_snRNP; Snu56-like U1 small nuclear ribonucleoprotein component (PF19097; HMM-score: 7.3)
  PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 7.1)
  Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 6.9)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Extracellular
  • Cytoplasmic Score: 0.24
  • Cytoplasmic Membrane Score: 0.05
  • Cellwall Score: 0.8
  • Extracellular Score: 8.91
  • Internal Helices: 0
• DeepLocPro: Cytoplasmic Membrane
  • Cytoplasmic Score: 0
  • Cytoplasmic Membrane Score: 0.9446
  • Cell wall & surface Score: 0.0119
  • Extracellular Score: 0.0434
• LocateP:
• SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
  • SP(Sec/SPI): 0.000361
  • TAT(Tat/SPI): 0.000046
  • LIPO(Sec/SPII): 0.999389
  • Cleavage Site: CS pos: 17-18. LTG-CG. Pr: 0.9999
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 446656085 NCBI
• RefSeq: WP_000733431 NCBI
• UniProt: see SAUSA300_0663

⊟Protein sequence

• MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQKDLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSADKDQKANDKHQS

⊟Experimental data

• experimentally validated: data available for COL, NCTC8325
• protein localization: data available for COL
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications