From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0632 [new locus tag: SA_RS03620 ]
  • pan locus tag?: SAUPAN002561000
  • symbol: SA0632
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA0632 [new locus tag: SA_RS03620 ]
  • symbol: SA0632
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 727461..727856
  • length: 396
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAGAAATTAATCATCAGTATTATGGCGGTCATGCTATTTTTAACAGGTTGTGGTAAA
    AGTCAAGAGAAAGCCACTCTGGAAAAGGATATCGATAATTTACAAAAAGAAAATAAAGAA
    TTAAAAGACAAAAAAGAAAAGCTTCAACAAGAAAAAGAAAAATTAGCAGATAAGCAAAAA
    GACCTTGAAAAAGAAGTGAAAGATTTAAAACCTTCAAAAGAAGATAACAAGGATGATAAA
    AAAGACGAAGACAAAAATAAAGACAAAGATAAAGATAAAGAGGCATCACAAGATAAGCAA
    TCAAAAGATCAAACTAAGTCATCGGATAAAGATAATCACAAAAAGCCTACATCAACAGAT
    AAAGATCAAAAAGCTAATGACAAACACCAATCATAA
    60
    120
    180
    240
    300
    360
    396


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA0632 [new locus tag: SA_RS03620 ]
  • symbol: SA0632
  • description: hypothetical protein
  • length: 131
  • theoretical pI: 9.36324
  • theoretical MW: 15218
  • GRAVY: -1.89771

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Sporulation and germination transcription factor, RsfA family (TIGR02894; HMM-score: 19.9)
    Signal transduction Regulatory functions DNA interactions transcription factor, RsfA family (TIGR02894; HMM-score: 19.9)
    Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 19.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 16.7)
    and 13 more
    SH3 domain protein (TIGR04211; HMM-score: 9.6)
    Cellular processes Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 8.1)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 6.7)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 5.6)
    type IV conjugative transfer system protein TraV (TIGR02747; HMM-score: 5.5)
    Genetic information processing Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 5.4)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 5.3)
    Cellular processes Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 5.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family (TIGR03592; HMM-score: 4.7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 4.3)
    Cellular processes Cellular processes Cell division cell division protein FtsN (TIGR02223; HMM-score: 4.3)
  • TheSEED  :
    • FIG01108219: hypothetical protein
  • PFAM:
    no clan defined TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 18.9)
    and 15 more
    Striatin; Striatin family (PF08232; HMM-score: 12.8)
    Leu_zip; Leucine zipper (PF15294; HMM-score: 12.2)
    DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 10.5)
    Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 10.4)
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 10.2)
    BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 10.2)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 9.7)
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 9.3)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 9.3)
    no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 9)
    NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 8.5)
    YabA; Initiation control protein YabA (PF06156; HMM-score: 7.8)
    Snu56_snRNP; Snu56-like U1 small nuclear ribonucleoprotein component (PF19097; HMM-score: 7.2)
    PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 7)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 6.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9452
    • Cell wall & surface Score: 0.012
    • Extracellular Score: 0.0428
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LFLTGCG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000361
    • TAT(Tat/SPI): 0.000046
    • LIPO(Sec/SPII): 0.999389
    • Cleavage Site: CS pos: 17-18. LTG-CG. Pr: 0.9999
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKKEKLQQEKEKLADKQKDLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQTKSSDKDNHKKPTSTDKDQKANDKHQS

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]