From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2648 [new locus tag: SAUSA300_RS14700 ]
  • pan locus tag?: SAUPAN006491000
  • symbol: rpmH
  • pan gene symbol?: rpmH
  • synonym:
  • product: 50S ribosomal protein L34

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2648 [new locus tag: SAUSA300_RS14700 ]
  • symbol: rpmH
  • product: 50S ribosomal protein L34
  • replicon: chromosome
  • strand: -
  • coordinates: 2872445..2872582
  • length: 138
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGGTAAAACGTACTTATCAACCAAATAAACGTAAACATAGTAAAGTTCATGGTTTCAGA
    AAACGCATGAGCACAAAAAATGGCCGTAAAGTTTTAGCGCGCCGTCGTCGTAAAGGCCGT
    AAAGTTTTATCTGCATAA
    60
    120
    138

Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SAUSA300_2648 [new locus tag: SAUSA300_RS14700 ]
  • symbol: RpmH
  • description: 50S ribosomal protein L34
  • length: 45
  • theoretical pI: 13.1142
  • theoretical MW: 5433.51
  • GRAVY: -1.56222

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL34 (TIGR01030; HMM-score: 69)
  • TheSEED  :
    • LSU ribosomal protein L34p
    Protein Metabolism Protein biosynthesis Ribosome LSU bacterial  LSU ribosomal protein L34p
  • PFAM:
    no clan defined Ribosomal_L34; Ribosomal protein L34 (PF00468; HMM-score: 79)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.1669
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.8331
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.119926
    • TAT(Tat/SPI): 0.064114
    • LIPO(Sec/SPII): 0.043919
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]