Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002701 [new locus tag: EGJ38_RS13485 ]
- pan locus tag?: SAUPAN006491000
- symbol: rpmH
- pan gene symbol?: rpmH
- synonym:
- product: 50S ribosomal protein L34
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002701 [new locus tag: EGJ38_RS13485 ]
- symbol: rpmH
- product: 50S ribosomal protein L34
- replicon: chromosome
- strand: -
- coordinates: 2718691..2718828
- length: 138
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424578 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGTAAAACGTACTTATCAACCAAATAAACGTAAACATAGTAAAGTTCATGGTTTCAGA
AAACGCATGAGCACAAAAAATGGCCGTAAAGTTTTAGCGCGCCGTCGTCGTAAAGGCCGT
AAAGTTTTATCTGCATAA60
120
138
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: EGJ38_002701 [new locus tag: EGJ38_RS13485 ]
- symbol: RpmH
- description: 50S ribosomal protein L34
- length: 45
- theoretical pI: 13.1142
- theoretical MW: 5433.51
- GRAVY: -1.56222
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL34 (TIGR01030; HMM-score: 69)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined Ribosomal_L34; Ribosomal protein L34 (PF00468; HMM-score: 79)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.1669
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.8331
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.119926
- TAT(Tat/SPI): 0.064114
- LIPO(Sec/SPII): 0.043919
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424578 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]