Jump to navigation
		Jump to search
		
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1335 [new locus tag: SAUSA300_RS07280 ]
- pan locus tag?: SAUPAN003899000
- symbol: SAUSA300_1335
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1335 [new locus tag: SAUSA300_RS07280 ]
- symbol: SAUSA300_1335
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1500291..1500623
- length: 333
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913515 NCBI
- RefSeq: YP_494032 NCBI
- BioCyc: see SAUSA300_RS07280
- MicrobesOnline: 1292850 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301ATGGGTAAAAAAATGGGTCTAGGTTTATCTATTGCATTGGTTGTTATTGGTATTGCCGTT
 GTATGTTTAATGATTTTTTCTAGTCAAAAAACGACTTATTTTGGTTATATGAATAGTAAT
 ACAAATGCAGAAAAAGTTGTCAGTGAAAAAGATGGATTAGTCAAACATAATATCAAAGTA
 GAACCATCTAATGATTTCAAGCCGAAAAAAGGAGACTTTGTAAAATTAGTTTCTAAAGAT
 GATGGGAAGACATTTTATAAACAAGAGATTGTTAAACATGATGACGTCCCACACGGTTTA
 ATGATGAAAATTCACGACATGCATATGAATTAA60
 120
 180
 240
 300
 333
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1335 [new locus tag: SAUSA300_RS07280 ]
- symbol: SAUSA300_1335
- description: hypothetical protein
- length: 110
- theoretical pI: 9.72436
- theoretical MW: 12316.4
- GRAVY: -0.213636
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED  : - FIG01108065: hypothetical protein
 
- PFAM: no clan defined DUF4889; Domain of unknown function (DUF4889) (PF16230; HMM-score: 131.3)and 3 moreOB (CL0021) YqiJ_OB; Inner membrane protein YqiJ, OB-fold (PF07290; HMM-score: 13.2)no clan defined BssC_TutF; BssC/TutF protein (PF08201; HMM-score: 12.7)SLATT (CL0676) SLATT_6; SMODS and SLOG-associating 2TM effector domain 6 (PF18169; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
 
- DeepLocPro: Cytoplasmic Membrane- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.86
- Cell wall & surface Score: 0.001
- Extracellular Score: 0.139
 
- LocateP: N-terminally anchored (No CS) - Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: 5
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: Signal peptide LIPO(Sec/SPII) length 21 aa- SP(Sec/SPI): 0.337021
- TAT(Tat/SPI): 0.00133
- LIPO(Sec/SPII): 0.351467
- Cleavage Site: CS pos: 21-22. AVV-CL. Pr: 0.2415
 
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGKKMGLGLSIALVVIGIAVVCLMIFSSQKTTYFGYMNSNTNAEKVVSEKDGLVKHNIKVEPSNDFKPKKGDFVKLVSKDDGKTFYKQEIVKHDDVPHGLMMKIHDMHMN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]