Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1482 [new locus tag: SACOL_RS07555 ]
- pan locus tag?: SAUPAN003899000
- symbol: SACOL1482
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1482 [new locus tag: SACOL_RS07555 ]
- symbol: SACOL1482
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1523578..1523910
- length: 333
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236284 NCBI
- RefSeq: YP_186327 NCBI
- BioCyc: see SACOL_RS07555
- MicrobesOnline: 912935 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGGTAAAAAAATGGGTCTAGGTTTATCTATTGCATTGGTTGTTATTGGTATTGCCGTT
GTATGTTTAATGATTTTTTCTAGTCAAAAAACGACTTATTTTGGTTATATGAATAGTAAT
ACAAATGCAGAAAAAGTTGTCAGTGAAAAAGATGGATTAGTCAAACATAATATCAAAGTA
GAACCATCTAATGATTTCAAGCCGAAAAAAGGAGGCTTTGTAAAATTAGTTTCTAAAGAT
GATGGGAAGACATTTTATAAACAAGAGATTGTTAAACATGATGACGTCCCACACGGTTTA
ATGATGAAAATTCACGACATGCATATGAATTAA60
120
180
240
300
333
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1482 [new locus tag: SACOL_RS07555 ]
- symbol: SACOL1482
- description: hypothetical protein
- length: 110
- theoretical pI: 9.9248
- theoretical MW: 12258.4
- GRAVY: -0.185455
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.8586
- Cell wall & surface Score: 0.0013
- Extracellular Score: 0.1401
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: 5
- Predicted Cleavage Site: No CleavageSite
- SignalP: Signal peptide LIPO(Sec/SPII) length 21 aa
- SP(Sec/SPI): 0.337021
- TAT(Tat/SPI): 0.00133
- LIPO(Sec/SPII): 0.351467
- Cleavage Site: CS pos: 21-22. AVV-CL. Pr: 0.2415
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGKKMGLGLSIALVVIGIAVVCLMIFSSQKTTYFGYMNSNTNAEKVVSEKDGLVKHNIKVEPSNDFKPKKGGFVKLVSKDDGKTFYKQEIVKHDDVPHGLMMKIHDMHMN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)