From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0900 [new locus tag: SAUSA300_RS15250 ]
  • pan locus tag?: SAUPAN003169000
  • symbol: SAUSA300_0900
  • pan gene symbol?:
  • synonym:
  • product: putative competence protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0900 [new locus tag: SAUSA300_RS15250 ]
  • symbol: SAUSA300_0900
  • product: putative competence protein
  • replicon: chromosome
  • strand: +
  • coordinates: 988576..988833
  • length: 258
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTTAGTAGCTTTAAATGAAGAAAAGGAACGCGTATTAGCAACTACTGCATTGAGAAAG
    ACACAATATTTTTGTCCGGTGTGTGGCAAGCAAGTTATTTTAAAGCGTGGGCTCAAAGTA
    ATTAGTCATTTTGCACATAAACATTTAGCGGAACAAAAATGTTTTAATAATGAAACGATT
    AAACATTATAAAAGTAAATTGATTTTAGCACAGATGATACAGCAACAAGGATGTAAAGTA
    GAGATAGAGCCATTTTAA
    60
    120
    180
    240
    258

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0900 [new locus tag: SAUSA300_RS15250 ]
  • symbol: SAUSA300_0900
  • description: putative competence protein
  • length: 85
  • theoretical pI: 9.94583
  • theoretical MW: 9840.67
  • GRAVY: -0.210588

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Competence protein CoiA
    DNA Metabolism DNA uptake, competence Gram Positive Competence  Competence protein CoiA
  • PFAM:
    PDDEXK (CL0236) CoiA; Competence protein CoiA-like family (PF06054; HMM-score: 51.9)
    and 5 more
    Zn_Beta_Ribbon (CL0167) HVO_2753_ZBP; Small zinc finger protein HVO_2753-like, Zn-binding pocket (PF07754; HMM-score: 15.8)
    Zn_ribbon_NOB1; Nin one binding (NOB1) Zn-ribbon like (PF08772; HMM-score: 15.6)
    C2H2-zf (CL0361) zf-Di19; Drought induced 19 protein (Di19), zinc-binding (PF05605; HMM-score: 14.7)
    no clan defined Cys_rich_KTR; Cysteine-rich KTR (PF14205; HMM-score: 13)
    DUF5795; Family of unknown function (DUF5795) (PF19108; HMM-score: 12.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9934
    • Cytoplasmic Membrane Score: 0.0015
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0049
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006438
    • TAT(Tat/SPI): 0.001641
    • LIPO(Sec/SPII): 0.003812
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLVALNEEKERVLATTALRKTQYFCPVCGKQVILKRGLKVISHFAHKHLAEQKCFNNETIKHYKSKLILAQMIQQQGCKVEIEPF

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]