Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0633 [new locus tag: SAUSA300_RS03395 ]
- pan locus tag?: SAUPAN002525000
- symbol: fhuA
- pan gene symbol?: fhuC
- synonym:
- product: ferrichrome transport ATP-binding protein fhuA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0633 [new locus tag: SAUSA300_RS03395 ]
- symbol: fhuA
- product: ferrichrome transport ATP-binding protein fhuA
- replicon: chromosome
- strand: +
- coordinates: 708131..708928
- length: 798
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913073 NCBI
- RefSeq: YP_493336 NCBI
- BioCyc: see SAUSA300_RS03395
- MicrobesOnline: 1292148 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781ATGAATCGTTTGCATGGACAACAAGTTAAAATTGGTTACGGGGATAACACGATTATAAAT
AAATTAGATGTTGAAATACCAGATGGCAAAGTGACGTCAATCATTGGTCCTAACGGCTGC
GGGAAATCTACTTTGCTAAAGGCATTGTCACGTTTATTGGCAGTTAAAGAAGGCGAAGTA
TTTTTAGATGGTGAAAATATTCATACACAATCTACGAAAGAGATTGCAAAAAAAATAGCC
ATTTTACCTCAATCACCTGAAGTAGCAGATGGCTTAACTGTTGGGGAATTAGTTTCATAT
GGTCGTTTTCCACATCAAAAAGGATTTGGTAGATTAACTGCTGAGGATAAGAAAGAAATT
GATTGGGCAATGGAAGTTACAGGAACTGATACATTCCGACACCGTTCAATCAATGATTTA
AGTGGTGGTCAAAGACAACGTGTTTGGATTGCAATGGCATTAGCACAAAGAACTGATATT
ATCTTTTTAGACGAACCAACAACATATTTAGATATCTGTCATCAATTAGAAATACTAGAA
TTAGTTCAGAAGCTAAATCAGGAACAAGGTTGTACAATTGTCATGGTTCTTCATGATATC
AACCAAGCGATTCGTTTCTCAGATCATCTTATTGCGATGAAAGAAGGGGATATCATCGCT
ACAGGTTCAACAGAAGACGTATTAACACAGGAAATATTAGAAAAAGTTTTTAATATTGAT
GTTGTTTTAAGTAAAGATCCTAAAACTGGAAAACCTTTACTGGTAACTTATGACTTATGT
CGCAGAGCTTATTCTTAA60
120
180
240
300
360
420
480
540
600
660
720
780
798
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0633 [new locus tag: SAUSA300_RS03395 ]
- symbol: FhuA
- description: ferrichrome transport ATP-binding protein fhuA
- length: 265
- theoretical pI: 5.63919
- theoretical MW: 29495.7
- GRAVY: -0.189434
⊟Function[edit | edit source]
- TIGRFAM: proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 231.7)and 87 moreTransport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 155.3)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 155)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 151.3)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 145.6)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 142.1)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 139.2)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 133.9)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 126.7)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 124.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 122.7)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 122.6)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 118.3)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 114)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 113.3)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 113.3)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 111.8)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 110.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 110.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 110.1)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 110)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 107.3)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 106.9)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 106.9)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 106.7)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 106.7)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 105.6)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 105.6)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 105.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 105.1)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 103.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 102.6)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 102.2)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 101.4)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 100.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 100.1)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 100.1)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 99.9)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 99.9)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 99.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 97.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 97.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 97.1)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 97)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 97)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 96.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 94.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 92.4)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 92.4)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 88.5)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 88.5)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 87.9)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 87.8)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 87.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 87.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 86.1)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 85.7)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 81.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 75)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 69.7)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 69.6)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 68.6)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 67.4)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 67.1)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 61.4)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 55.3)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 55.3)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 53.3)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 52.1)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 47.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 46.2)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 19.8)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 18.9)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 18.9)4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, N-terminal subunit (TIGR02305; EC 4.1.1.68,5.3.3.10; HMM-score: 17.1)carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 16.9)Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 16.4)DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 15.6)Cellular processes Sporulation and germination stage III sporulation protein AA (TIGR02858; HMM-score: 14.3)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 14)DNA repair and recombination protein RadB (TIGR02237; HMM-score: 13.3)Central intermediary metabolism Nitrogen metabolism urease accessory protein UreG (TIGR00101; HMM-score: 12.5)4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, C-terminal subunit (TIGR02303; EC 4.1.1.68,5.3.3.10; HMM-score: 12.1)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions cytidylate kinase (TIGR00017; EC 2.7.4.14; HMM-score: 11.4)Protein fate Degradation of proteins, peptides, and glycopeptides proteasome ATPase (TIGR03689; EC 3.6.4.8; HMM-score: 11.2)restriction system-associated AAA family ATPase (TIGR04435; HMM-score: 10.6)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 10.1)rad50 (TIGR00606; HMM-score: 10)
- TheSEED :
- Ferrichrome ABC transporter, ATP-binding protein FhuC
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 120.9)and 37 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 40.6)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 39)AAA_15; AAA ATPase domain (PF13175; HMM-score: 36.5)ABC_ATPase; P-loop domain (PF09818; HMM-score: 32.5)AAA_14; AAA domain (PF13173; HMM-score: 27.7)AAA_23; AAA domain (PF13476; HMM-score: 27.7)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 27.2)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 22.9)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 20)AAA_25; AAA domain (PF13481; HMM-score: 19.6)AAA_22; AAA domain (PF13401; HMM-score: 19.2)AAA_28; AAA domain (PF13521; HMM-score: 19)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 17.5)DUF2813; Protein of unknown function (DUF2813) (PF11398; HMM-score: 17.5)AAA_27; AAA domain (PF13514; HMM-score: 17.4)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.2)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 17)AAA_18; AAA domain (PF13238; HMM-score: 16.6)Spore_III_AA; Sporulation stage III, protein AA (PF19568; HMM-score: 16.6)AAA_16; AAA ATPase domain (PF13191; HMM-score: 16.5)NACHT; NACHT domain (PF05729; HMM-score: 16.2)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 15.8)AAA_33; AAA domain (PF13671; HMM-score: 15.4)RNA_helicase; RNA helicase (PF00910; HMM-score: 15)APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 14.9)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 14.3)ORC-CDC6-like; ORC-CDC6-like (PF24389; HMM-score: 14.3)AAA_19; AAA domain (PF13245; HMM-score: 14.1)AAA_30; AAA domain (PF13604; HMM-score: 14.1)NB-ARC; NB-ARC domain (PF00931; HMM-score: 13.8)AAA_24; AAA domain (PF13479; HMM-score: 13.5)NADP_Rossmann (CL0063) NAD_binding_2; NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446; HMM-score: 13.3)P-loop_NTPase (CL0023) MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 12.8)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 12.2)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 12.2)ATPase; KaiC (PF06745; HMM-score: 12.1)Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 10.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1172
- Cytoplasmic Membrane Score: 0.8819
- Cell wall & surface Score: 0
- Extracellular Score: 0.0009
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012674
- TAT(Tat/SPI): 0.000308
- LIPO(Sec/SPII): 0.001864
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTLLKALSRLLAVKEGEVFLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFPHQKGFGRLTAEDKKEIDWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFLDEPTTYLDICHQLEILELVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATGSTEDVLTQEILEKVFNIDVVLSKDPKTGKPLLVTYDLCRRAYS
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_2142 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SAUSA300_0760 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SAUSA300_1080 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SAUSA300_0523 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_1149 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) SAUSA300_2187 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_2179 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_0533 (tuf) elongation factor Tu [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: fhuA > fhuB > fhuG
⊟Regulation[edit | edit source]
- regulator: Fur* (repression) regulon
Fur* (TF) important in Iron homeostasis; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)