Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0233 [new locus tag: SAUSA300_RS01235 ]
- pan locus tag?: SAUPAN001104000
- symbol: SAUSA300_0233
- pan gene symbol?: —
- synonym: JSNZ_000176
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0233 [new locus tag: SAUSA300_RS01235 ]
- symbol: SAUSA300_0233
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 281010..281183
- length: 174
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913488 NCBI
- RefSeq: YP_492947 NCBI
- BioCyc: see SAUSA300_RS01235
- MicrobesOnline: 1291748 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAACTTAATCAACGTTACGTAAAAGTATTTGCATTATATTTCGTAAGTATTGTTACT
GCAAATATTATTGTTAAAAATAATAATTTAATTAAAACATTGATACAAACCATAGCCGGG
TACACGGTCTTTGCAGTTGGTTTGAAGTATTTAACTAAACGTAAAAATAAATGA60
120
174
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0233 [new locus tag: SAUSA300_RS01235 ]
- symbol: SAUSA300_0233
- description: hypothetical protein
- length: 57
- theoretical pI: 11.0923
- theoretical MW: 6564.9
- GRAVY: 0.319298
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0007
- Cytoplasmic Membrane Score: 0.969
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.03
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.143631
- TAT(Tat/SPI): 0.00063
- LIPO(Sec/SPII): 0.078405
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLNQRYVKVFALYFVSIVTANIIVKNNNLIKTLIQTIAGYTVFAVGLKYLTKRKNK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]