⊟Summary[edit | edit source]
- pan ID?: SAUPAN005125000
- symbol?: —
- synonym:
- description?: XRE family transcriptional regulator
- XRE family transcriptional regulator
- helix-turn-helix domain-containing protein
- phage cI-like repressor
- phi77 ORF011-like protein, phage transcriptional repressor
- phage transcriptional regulator
- CI-like repressor, phage associated
- helix-turn-helix family protein
- peptidase S24 S26A and S26B
- phage repressor
- Phage transcriptional repressor
- putative phage repressor protein
- repressor-like protein
- transcription regulator
descriptions from strain specific annotations:
- strand?: +
- coordinates?: 5264707..5269215
- synteny block?: BlockID0039780
- occurrence?: in 59% of 34 strains
cI : prophage induction repressor cI
Staphylococcal prophage typically employ a lysogenic-lytic regulatory switch analogous to the cI-cro system in coliphage lambda. cI binding drives "leftward" transcription of lysogeny modules only. Some prophage separate cI's DNA-binding and proteolytic domains into two distinct proteins resulting in the truncated transcriptional repressor cI* and a separate cI*-specific endopeptidase. Strong evolutionary pressures drive diversity in cI-cro DNA operator sequences to allow independent regulation of prophages in the context of multiple integrated prophage. Known or suspected operator sequences are reproduced below:
| Prophage Prototype | Accession Number | cI protein | DNA-binding residues | Crystal Structure | cI Operator | mor protein | DNA binding residues | Crystal Structure | mor Operator | cI-mor heterodimer | References |
|---|---|---|---|---|---|---|---|---|---|---|---|
| φ11 | AF424781 | AAL82233.1 | Q25, D26, A37, S40, T44, G45 | TTTRC-n5-GTRTA | AAL82234.1 | Q16, E17, E28, R31, L35, G36 | TACACG-n3-CGTGTA | No | [1] | ||
| φ12 | AF424782 | AAL82286.1 | Q24, K25, S36, S39, N43, L44 | n.a. | ATAYGAAA-n-TTTCRTAT | AAL82287.1 | Q15, K16, R27, Q30, K34, D35 | 3MLF | WWMGWAAAR | Yes | [1] |
| φ13 | AF424783 | AAL82333.1 | P29, Y30, S41, S44, N48, D49 | AGTTCATR-n3-CRTGAAYT | AAL82334.1 | Q19, Y20, R31, S34, N38, G39 | TSAAYAMAA | Yes | [1] | ||
| φ29 | AY954964 | AAX91741.1 | — | AYWWTACG-n7-CGTAWWRT | AAX91764.1 | Q24, A25, D36, H39, K43, G44 | |||||
| φ47 | AY954957 | AAX91211.1 | DWHRAMAC-n4-GTKTYDWH | AAX91242.1 | — | ||||||
| φ77 | AY508486 | AAR87883.1 | P28, F29, S40, S43, N47, G48 | n.a. | TYMAMW-n-WKTKRA | AAR87930.1 | — | n.a. | AYAAAAR | Yes | [2] |
| φ80α | DQ517338 | ABF71577.1 | Q19, S20, N31, S34, N38, G39 | WTGTACAK-n4-CYGWACAA | ABF71578.1 | Q21, S22, T33, N36, Q40, G41 | TWCATWT | Yes | [3] | ||
| φCA347 | M18, E19, G38, S41, N45, E46 | WCGAAACW | Q24, K25, S36, S39, N46, G47 | YRACAACTW | Yes | [4] | |||||
| φNM1 | AP009351 | BAF68084.1 | K18, V19, G30, R33, S37, G38 | WTWYTW-n2-WARWAW | YWWTTA | Yes | [5] | ||||
| φST9-B | L18, Q19, G41, S44, N48, N49 | N18, K19, T30, N33, N37, N40 | |||||||||
| φX2 | AY954968 | AAX92026.1 | V18, K19, T30, R33, R38, G39 | ATACGAAAA | AAX92036.1 | L16, V17, Q28, S31, N35, G36 | [6] | ||||
| Prophage Prototype | Accession Number | cI* Protein | DNA-binding residues | Crystal Structure | cI* Operator | mor protein | DNA-binding residues | Crystal Structure | mor Operator | cI*-mor heterodimer | References |
| φ80 | DQ908929 | ABJ88853.1 | Q25, V26, S37, S40, K44, E45 | TATYAC-n5-GTRATA | ABJ88854.1 | Q21, Q22, Q33, I36, K40, D41 | [7] | ||||
| φ88 | AY954966 | AAX91907.1 | Q21, T22, S33, S36, N40, A41 | AAX91914.1 | Q21, E22, A33, I36, K40, G41 | [8] | |||||
| φR4 | MT366568 | QJT70710.1 | Q25, R26, P37, S40, Q44, Q45 | GTAATA | QJT70730.1 | Q18, Q19, K30, G33, K37, D38 | [9] | ||||
| φROSA | NC_007058 | YP_240340.1 | L22, T23, S34, S37, N41, G42 | YP_240342.1 | I20, S21, G32, S35, N39, G40 | [10] | |||||
| φ187 (SA675) | AY954950 | AAX90724.1 | L22, S23, S34, S37, N41, L42 | AWTARCD-n4-HGYTAWT | AAX90725.1 | Q19, D20, R31, A35, D39, G40 | [11] | ||||
| φSA75 | MT013111 | QIA28762.1 | GAAATKTR | QIA28763.1 | N21, K22, A33, S36, R40, G41 | [12] | |||||
| φSLT | AB045978 | BAB21700.1 | L18, A19, A30, Q33, S37, G38 | AAAASTTTMG | I19, K20, D31, S34, H38, G39 | [13] |
For annotation of individual genomes, a recommended naming convention would be to use the prophage prototype in the description, as in "prophage φ12-like induction repressor cI" for SAUSA300_1969 from strain USA300_FPR3757.
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
| N315 | |
| NCTC8325 | |
| Newman | |
| USA300_FPR3757 | |
| JSNZ |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.505)
N315 MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
NCTC8325 MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
Newman MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
USA300_FPR3757 MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
JSNZ MSS-----FSSNLERLMNKRDMSDSELAELVDVNRTTVTRWRKGIRSPKLDKLPEIANVF
*.. ::.*:.:::*. :**:.:****:::: :*:: : : .*. . : .**:**
N315 EVGKSDIDTTYKDDNDITSIYN---KLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYK
NCTC8325 EVGKSDIDTTYKDDNDITSIYN---KLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYK
Newman EVGKSDIDTTYKDDNDITSIYN---KLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYK
USA300_FPR3757 EVGKSDIDTTYKDDNDITSIYN---KLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYK
JSNZ GVKPLDLIHEMDDSKVIEEIHNISSQLTPPRQSNVLNYANSQLDEQNSKGDNVVDINSYK
* *: .*.: * .*:* :******.*******.**:****************
N315 QEKTPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFV
NCTC8325 QEKTPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFV
Newman QEKTPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFV
USA300_FPR3757 QEKTPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFV
JSNZ QDKTPVNVNGCVSAGVGERLHDETLFTEMVKGPVPPHDLALKVNGDSMEPMFKNGEIIFV
*:*******************************:*.*****************:******
N315 EKTHNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
NCTC8325 EKTHNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
Newman EKTHNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
USA300_FPR3757 EKTHNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
JSNZ EKTHNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKEYRDLHFYRNESVRLVGKVIL
***************************************:* ************:*****
- ↑ 1.0 1.1 1.2 John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p)Tony Kwan, Jing Liu, Michael DuBow, Philippe Gros, Jerry Pelletier
The complete genomes and proteomes of 27 Staphylococcus aureus bacteriophages.
Proc Natl Acad Sci U S A: 2005, 102(14);5174-9
[PubMed:15788529] [WorldCat.org] [DOI] (P p)Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Margit Pedersen, Karin Hammer
The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
J Mol Biol: 2008, 384(3);577-89
[PubMed:18930065] [WorldCat.org] [DOI] (I p)Anindya Biswas, Sukhendu Mandal, Subrata Sau
Identification and characterization of a CI binding operator at a distant location in the temperate staphylococcal phage ф11.
FEMS Microbiol Lett: 2017, 364(20);
[PubMed:28961814] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p)Mohammed A Thabet, José R Penadés, Andreas F Haag
The ClpX protease is essential for inactivating the CI master repressor and completing prophage induction in Staphylococcus aureus.
Nat Commun: 2023, 14(1);6599
[PubMed:37852980] [WorldCat.org] [DOI] (I e) - ↑ Jing Liu, Mohammed Dehbi, Greg Moeck, Francis Arhin, Pascale Bauda, Dominique Bergeron, Mario Callejo, Vincent Ferretti, Nhuan Ha, Tony Kwan, John McCarty, Ramakrishnan Srikumar, Dan Williams, Jinzi J Wu, Philippe Gros, Jerry Pelletier, Michael DuBow
Antimicrobial drug discovery through bacteriophage genomics.
Nat Biotechnol: 2004, 22(2);185-91
[PubMed:14716317] [WorldCat.org] [DOI] (P p)Tony Kwan, Jing Liu, Michael DuBow, Philippe Gros, Jerry Pelletier
The complete genomes and proteomes of 27 Staphylococcus aureus bacteriophages.
Proc Natl Acad Sci U S A: 2005, 102(14);5174-9
[PubMed:15788529] [WorldCat.org] [DOI] (P p)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p) - ↑ Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p) - ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p)Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Margit Pedersen, Karin Hammer
The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
J Mol Biol: 2008, 384(3);577-89
[PubMed:18930065] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p) - ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p) - ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p)Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Margit Pedersen, Karin Hammer
The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
J Mol Biol: 2008, 384(3);577-89
[PubMed:18930065] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p) - ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p)Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Margit Pedersen, Karin Hammer
The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
J Mol Biol: 2008, 384(3);577-89
[PubMed:18930065] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p) - ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p)Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Margit Pedersen, Karin Hammer
The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
J Mol Biol: 2008, 384(3);577-89
[PubMed:18930065] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p) - ↑ Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p)Botond Zsombor Pertics, Dalma Szénásy, Dániel Dunai, Yannick Born, Lars Fieseler, Tamás Kovács, György Schneider
Isolation of a Novel Lytic Bacteriophage against a Nosocomial Methicillin-Resistant Staphylococcus aureus Belonging to ST45.
Biomed Res Int: 2020, 2020;5463801
[PubMed:33426055] [WorldCat.org] [DOI] (I e)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)Margit Pedersen, Karin Hammer
The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
J Mol Biol: 2008, 384(3);577-89
[PubMed:18930065] [WorldCat.org] [DOI] (I p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p) - ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p)Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Margit Pedersen, Karin Hammer
The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
J Mol Biol: 2008, 384(3);577-89
[PubMed:18930065] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p) - ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p)Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Margit Pedersen, Karin Hammer
The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
J Mol Biol: 2008, 384(3);577-89
[PubMed:18930065] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p) - ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p)Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Margit Pedersen, Karin Hammer
The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
J Mol Biol: 2008, 384(3);577-89
[PubMed:18930065] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p) - ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
Gene: 2002, 289(1-2);109-18
[PubMed:12036589] [WorldCat.org] [DOI] (P p)Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
Mol Microbiol: 2007, 64(6);1515-28
[PubMed:17511812] [WorldCat.org] [DOI] (P p)Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
A conserved anti-repressor controls horizontal gene transfer by proteolysis.
Mol Microbiol: 2008, 70(3);570-82
[PubMed:18761623] [WorldCat.org] [DOI] (I p)Margit Pedersen, Karin Hammer
The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
J Mol Biol: 2008, 384(3);577-89
[PubMed:18930065] [WorldCat.org] [DOI] (I p)Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
Coordination of cohabiting phage elements supports bacteria-phage cooperation.
Nat Commun: 2019, 10(1);5288
[PubMed:31754112] [WorldCat.org] [DOI] (I e)Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
Microbiologyopen: 2021, 10(5);e1245
[PubMed:34713608] [WorldCat.org] [DOI] (I p)