PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

⊟Summary

• organism: Staphylococcus aureus N315
• locus tag: SAS044 [new locus tag: SA_RS06800 ]
• pan locus tag^?: SAUPAN003756000
• symbol: SAS044
• pan gene symbol^?: dmpI
• synonym:
• product: 4-oxalocrotonate tautomerase

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAS044 [new locus tag: SA_RS06800 ]
• symbol: SAS044
• product: 4-oxalocrotonate tautomerase
• replicon: chromosome
• strand: -
• coordinates: 1368054..1368242
• length: 189
• essential: no DEG other strains

⊟Accession numbers

• Gene ID: 1124034 NCBI
• RefSeq: NP_374476 NCBI
• BioCyc: see SA_RS06800
• MicrobesOnline: 103502 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  
  ATGATGCCAATCGTCAATGTAAAATTATTAGAAGGTCGTTCGGATGAACAATTAAAAAAT
  TTAGTTAGCGAAGTAACTGACGCCGTAGAAAAAACAACGGGGGCAAATAGACAAGCAATT
  CACGTTGTTATAGAAGAAATGAAACCAAACCATTATGGTGTGGCTGGCGTAAGAAAGTCA
  GATCAATAA
  60
  120
  180
  189
  

⊟Protein

⊟General

• locus tag: SAS044 [new locus tag: SA_RS06800 ]
• symbol: SAS044
• description: 4-oxalocrotonate tautomerase
• length: 62
• theoretical pI: 6.51944
• theoretical MW: 6874.83
• GRAVY: -0.429032

⊟Function

• reaction:
  EC 5.3.2.-?  ExPASy
• TIGRFAM:
  Metabolism Energy metabolism Other 4-oxalocrotonate tautomerase family enzyme (TIGR00013; EC 5.3.2.-; HMM-score: 79.1)
• TheSEED  :
  • 2-hydroxymuconate tautomerase-like protein YwhB (Bsu3751)
• PFAM:
  MIF (CL0082) Tautomerase; Tautomerase enzyme (PF01361; HMM-score: 85.4)
  and 1 more
  Tautomerase_2; Tautomerase enzyme (PF14552; HMM-score: 24.3)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic
  • Cytoplasmic Score: 7.5
  • Cytoplasmic Membrane Score: 1.15
  • Cellwall Score: 0.62
  • Extracellular Score: 0.73
  • Internal Helices: 0
• LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 1
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: -1
  • Predicted Cleavage Site: No CleavageSite
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.004592
  • TAT(Tat/SPI): 0.001069
  • LIPO(Sec/SPII): 0.001221
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 15926943 NCBI
• RefSeq: NP_374476 NCBI
• UniProt: P99132 UniProt

⊟Protein sequence

• MMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSDQ

⊟Experimental data

• experimentally validated: data available for COL, NCTC8325
• protein localization: data available for COL
• quantitative data / protein copy number per cell: data available for COL
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: no polycistronic organisation predicted

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)