Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS044 [new locus tag: SA_RS06800 ]
- pan locus tag?: SAUPAN003756000
- symbol: SAS044
- pan gene symbol?: dmpI
- synonym: JSNZ_001347
- product: 4-oxalocrotonate tautomerase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS044 [new locus tag: SA_RS06800 ]
- symbol: SAS044
- product: 4-oxalocrotonate tautomerase
- replicon: chromosome
- strand: -
- coordinates: 1368054..1368242
- length: 189
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124034 NCBI
- RefSeq: NP_374476 NCBI
- BioCyc: see SA_RS06800
- MicrobesOnline: 103502 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATGCCAATCGTCAATGTAAAATTATTAGAAGGTCGTTCGGATGAACAATTAAAAAAT
TTAGTTAGCGAAGTAACTGACGCCGTAGAAAAAACAACGGGGGCAAATAGACAAGCAATT
CACGTTGTTATAGAAGAAATGAAACCAAACCATTATGGTGTGGCTGGCGTAAGAAAGTCA
GATCAATAA60
120
180
189
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS044 [new locus tag: SA_RS06800 ]
- symbol: SAS044
- description: 4-oxalocrotonate tautomerase
- length: 62
- theoretical pI: 6.51944
- theoretical MW: 6874.83
- GRAVY: -0.429032
⊟Function[edit | edit source]
- reaction: EC 5.3.2.-? ExPASy
- TIGRFAM: Energy metabolism Other 4-oxalocrotonate tautomerase family enzyme (TIGR00013; EC 5.3.2.-; HMM-score: 79.1)
- TheSEED :
- 2-hydroxymuconate tautomerase-like protein YwhB (Bsu3751)
- PFAM: MIF (CL0082) Tautomerase; Tautomerase enzyme (PF01361; HMM-score: 90.6)and 1 moreTautomerase_2; Tautomerase enzyme (PF14552; HMM-score: 23.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9924
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0
- Extracellular Score: 0.0073
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004592
- TAT(Tat/SPI): 0.001069
- LIPO(Sec/SPII): 0.001221
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSDQ
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)