From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1275 [new locus tag: NWMN_RS07190 ]
  • pan locus tag?: SAUPAN003756000
  • symbol: NWMN_1275
  • pan gene symbol?: dmpI
  • synonym:
  • product: 4-oxalocrotonate tautomerase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1275 [new locus tag: NWMN_RS07190 ]
  • symbol: NWMN_1275
  • product: 4-oxalocrotonate tautomerase
  • replicon: chromosome
  • strand: -
  • coordinates: 1405881..1406069
  • length: 189
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATGCCAATCGTCAATGTAAAATTATTAGAAGGTCGTTCGGATGAACAATTAAAAAAT
    TTAGTTAGCGAAGTAACTGACGCCGTAGAAAAAACAACGGGGGCAAATAGACAAGCAATT
    CACGTTGTTATAGAAGAAATGAAACCAAACCATTATGGTGTGGCTGGCGTAAGAAAGTCA
    GATCAATAA
    60
    120
    180
    189

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_1275 [new locus tag: NWMN_RS07190 ]
  • symbol: NWMN_1275
  • description: 4-oxalocrotonate tautomerase
  • length: 62
  • theoretical pI: 6.51944
  • theoretical MW: 6874.83
  • GRAVY: -0.429032

Function[edit | edit source]

  • reaction:
    EC 5.3.2.-?  ExPASy
  • TIGRFAM:
    Metabolism Energy metabolism Other 4-oxalocrotonate tautomerase family enzyme (TIGR00013; EC 5.3.2.-; HMM-score: 79.1)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    MIF (CL0082) Tautomerase; Tautomerase enzyme (PF01361; HMM-score: 85.4)
    and 1 more
    Tautomerase_2; Tautomerase enzyme (PF14552; HMM-score: 24.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004592
    • TAT(Tat/SPI): 0.001069
    • LIPO(Sec/SPII): 0.001221
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSDQ

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]